| Clone Name | rbags3e20 |
|---|---|
| Clone Library Name | barley_pub |
>PREA_CYAPA (P31171) Prenyl transferase (EC 2.5.1.-)| Length = 323 Score = 39.3 bits (90), Expect = 0.005 Identities = 20/53 (37%), Positives = 35/53 (66%) Frame = -3 Query: 440 LQKSRGIERTKELAQEHVNLAVKAIESLPDSDDEDVLISRRALIDITQRVITR 282 +++++ IE+T+ELA EH +A++ +E+LP S S+ AL IT+ V+ R Sbjct: 275 VEETKAIEKTRELAMEHAQVAIQCLENLPPSS------SKEALKLITKYVLER 321
>COQ1_NEUCR (Q7S565) Probable hexaprenyl pyrophosphate synthetase,| mitochondrial precursor (EC 2.5.1.-) (HPS) Length = 449 Score = 38.1 bits (87), Expect = 0.011 Identities = 17/36 (47%), Positives = 26/36 (72%) Frame = -3 Query: 434 KSRGIERTKELAQEHVNLAVKAIESLPDSDDEDVLI 327 +S GIE+T+ LAQ++ A++AI PDS+ +D LI Sbjct: 403 QSNGIEQTRALAQDYAEKAIEAISGFPDSEAKDGLI 438
>COQ1_YARLI (Q6CBH3) Probable hexaprenyl pyrophosphate synthetase,| mitochondrial precursor (EC 2.5.1.-) (HPS) Length = 452 Score = 37.4 bits (85), Expect = 0.019 Identities = 20/55 (36%), Positives = 37/55 (67%) Frame = -3 Query: 440 LQKSRGIERTKELAQEHVNLAVKAIESLPDSDDEDVLISRRALIDITQRVITRTK 276 +Q++ G+ RT+ELAQ++ + AV ++ LP S+ SR AL ++T +++ R+K Sbjct: 404 VQQADGLSRTRELAQKYCDEAVANLDLLPYSE------SREALRNLTMKMMNRSK 452
>PPGB_HUMAN (P10619) Lysosomal protective protein precursor (EC 3.4.16.5)| (Cathepsin A) (Carboxypeptidase C) (Protective protein for beta-galactosidase) [Contains: Lysosomal protective protein 32 kDa chain; Lysosomal protective protein 20 kDa chain] Length = 480 Score = 31.2 bits (69), Expect = 1.3 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +1 Query: 79 PPVTKTTIAATMTIPRNGYPEVSSNVTQKLGQWKECN 189 PP T TT A+T N Y + N+ ++L QW CN Sbjct: 329 PPCTNTTAASTYL--NNPYVRKALNIPEQLPQWDMCN 363
>G3P_RALSO (P52694) Glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)| (GAPDH) Length = 332 Score = 28.5 bits (62), Expect = 8.7 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 434 KSRGIERTKELAQEHVNL-AVKAIESLPDSDDEDVLI 327 +S GI TKE AQ+H++ A K I S P DD + + Sbjct: 96 ESTGIFLTKEGAQKHIDAGAKKVIMSAPSKDDTPMFV 132
>SIP1_HUMAN (O60315) Zinc finger homeobox protein 1b (Smad-interacting protein| 1) (SMADIP1) Length = 1214 Score = 28.5 bits (62), Expect = 8.7 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Frame = +2 Query: 128 MVTLK----SHQMLHKNSGNGKNAMTKASKIFQVEHYTGE 235 MVT K HQML + +GN K T+ K F+ +H+ E Sbjct: 260 MVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKE 299
>PYRD_PSESM (Q883P1) Dihydroorotate dehydrogenase (EC 1.3.3.1) (Dihydroorotate| oxidase) (DHOdehase) (DHODase) (DHOD) Length = 343 Score = 28.5 bits (62), Expect = 8.7 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = -3 Query: 416 RTKELAQEHVNLAVKAIESLPDSDDEDVLISRRALIDITQRVITRTK*QDYTQGGE 249 R +EL Q H AI+ PD DE+ ++ ALI+ + T QG E Sbjct: 199 RQQELTQRHGKRVPLAIKIAPDMTDEETVLVAAALIESGMDAVIATNTTLSRQGVE 254
>SIP1_MOUSE (Q9R0G7) Zinc finger homeobox protein 1b (Smad-interacting protein| 1) Length = 1215 Score = 28.5 bits (62), Expect = 8.7 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Frame = +2 Query: 128 MVTLK----SHQMLHKNSGNGKNAMTKASKIFQVEHYTGE 235 MVT K HQML + +GN K T+ K F+ +H+ E Sbjct: 260 MVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKE 299
>MCM6Z_XENTR (Q6P1V8) Zygotic DNA replication licensing factor mcm6 (Zygotic| minichromosome maintenance protein 6) (zMCM6) Length = 823 Score = 28.5 bits (62), Expect = 8.7 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = -3 Query: 440 LQKSRGIERTKELAQEHVNLAVKAIESLPDSDDEDVLISRRALID 306 L+K + T + E +N +K IES DS++E L++R+ +ID Sbjct: 734 LRKMEDEDETSQRKSELINWYLKEIESEIDSEEE--LVTRKQIID 776 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,631,383 Number of Sequences: 219361 Number of extensions: 1159437 Number of successful extensions: 3622 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3622 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)