| Clone Name | rbags3c24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y209_ENCCU (Q8SWH3) Hypothetical protein ECU02_0090 | 33 | 0.80 | 2 | HBL1_CAEEL (Q9XYD3) Hunchback-like protein | 30 | 5.2 |
|---|
>Y209_ENCCU (Q8SWH3) Hypothetical protein ECU02_0090| Length = 258 Score = 32.7 bits (73), Expect = 0.80 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 10/85 (11%) Frame = -3 Query: 512 IKESTLVYL*CLFIQVSIFSQLV---------DIFLY-IVGGSIKLNSSSYSYIKCFFIT 363 I STL+ L F+ ++IFS + D+F Y I+ S + + C FIT Sbjct: 87 ILHSTLIVLLLAFVIINIFSSITFVTDKWNSEDLFFYSIILPSFFIPPTYLLSTSCDFIT 146 Query: 362 SSFYTTLTSSIMDIFCDLKLLISVL 288 +SF T++ ++I DL +L+S L Sbjct: 147 TSF----TATGINILVDLMILLSYL 167
>HBL1_CAEEL (Q9XYD3) Hunchback-like protein| Length = 982 Score = 30.0 bits (66), Expect = 5.2 Identities = 20/101 (19%), Positives = 45/101 (44%) Frame = +2 Query: 14 IHLLGLHNTITHLMNTFSYTGI*QERTELHNRTMAHLLTMEFIPLSYET*VQKFLCCVDL 193 + L+GL N++ + + + E +M+H+L +P S + L Sbjct: 721 VGLMGLRNSVMSPLKCSACDFVASSADEKMRHSMSHILNSSNVPTSIASLYN------SL 774 Query: 194 NVPSRHHRHLLTTFLATEKETKQKTLDHDIRPEQISVTSNH 316 N+PS H +A + + +++D D++ + ++T +H Sbjct: 775 NLPSFSH-------VAPDNDNALESMDCDVKIDDDNITESH 808 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,246,074 Number of Sequences: 219361 Number of extensions: 1410214 Number of successful extensions: 2478 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2478 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)