| Clone Name | rbags1g22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ISW1_YEAST (P38144) Chromatin remodelling complex ATPase chain I... | 30 | 2.9 | 2 | FSHR_MACEU (Q6YNB6) Follicle-stimulating hormone receptor precur... | 30 | 3.7 | 3 | ASSY_CLOPE (Q8XMJ7) Argininosuccinate synthase (EC 6.3.4.5) (Cit... | 29 | 6.4 | 4 | EGF_FELCA (Q95ND4) Pro-epidermal growth factor precursor (EGF) [... | 29 | 8.3 |
|---|
>ISW1_YEAST (P38144) Chromatin remodelling complex ATPase chain ISW1 (EC| 3.6.1.-) Length = 1129 Score = 30.4 bits (67), Expect = 2.9 Identities = 26/106 (24%), Positives = 41/106 (38%), Gaps = 18/106 (16%) Frame = +3 Query: 108 SSHEKRW--------LSAVTG----------MATMFRKRKRCCNNPILGVRNPGQR*DGV 233 SS +K+W L AV G + + + ++CCN+P L DG Sbjct: 434 SSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHPYLF--------DGA 485 Query: 234 CRSPCYVRERRLIQXXPGTNVLDALLDNRNQLVLGICYFSEIASTL 371 P Y + L+ VLD LL + + FS+++ L Sbjct: 486 EPGPPYTTDEHLVYNAAKLQVLDKLLKKLKEEGSRVLIFSQMSRLL 531
>FSHR_MACEU (Q6YNB6) Follicle-stimulating hormone receptor precursor (FSH-R)| (Follitropin receptor) Length = 694 Score = 30.0 bits (66), Expect = 3.7 Identities = 18/73 (24%), Positives = 30/73 (41%) Frame = -2 Query: 308 KSIKHICARSXLDQSSFTNVARRATHTILALSGIAHXKDRVVATPFPFPKHCCHACDGRE 129 K++K + ARS + + N+ + A +V +P HCC + R Sbjct: 239 KNLKKLKARSAYNFKTLPNLDKFA---------------ELVEANLTYPSHCCAFANWRR 283 Query: 128 PAFLMRTICSSCF 90 AF + IC+ F Sbjct: 284 QAFELHPICNKSF 296
>ASSY_CLOPE (Q8XMJ7) Argininosuccinate synthase (EC 6.3.4.5)| (Citrulline--aspartate ligase) Length = 405 Score = 29.3 bits (64), Expect = 6.4 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 76 PTNELKHDEQIVLMRNAGSRPSQAWQQCLGKGKGVATTLS 195 P NE K+D+ + L P++A LG KG+AT+L+ Sbjct: 197 PENEPKYDKILELCNTLEKAPNEAEYITLGFEKGIATSLN 236
>EGF_FELCA (Q95ND4) Pro-epidermal growth factor precursor (EGF) [Contains:| Epidermal growth factor] Length = 1210 Score = 28.9 bits (63), Expect = 8.3 Identities = 18/62 (29%), Positives = 26/62 (41%) Frame = -1 Query: 369 GWKQFPRSSKCQGPADSYCQEEHQAHLCPVXIGSIFFHERSTASDTHHLSVVRDCAXQG* 190 G K R C G S C+++ ++HLC G + + D H V +CA Sbjct: 312 GQKLCLRKGNCTG---SVCEQDSKSHLCTCAEG------YTLSPDGKHCEDVNECAFWNH 362 Query: 189 GC 184 GC Sbjct: 363 GC 364 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,318,062 Number of Sequences: 219361 Number of extensions: 1167646 Number of successful extensions: 2476 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2474 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)