| Clone Name | rbags1g19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DME_ARATH (Q8LK56) Transcriptional activator DEMETER (DNA glycos... | 29 | 3.0 | 2 | AT8B1_HUMAN (O43520) Probable phospholipid-transporting ATPase I... | 28 | 8.8 |
|---|
>DME_ARATH (Q8LK56) Transcriptional activator DEMETER (DNA glycosylase-related| protein DME) Length = 1729 Score = 29.3 bits (64), Expect = 3.0 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = -2 Query: 136 PKICCLSHSETPSTQERVPEISFRSRSIVDAGKTEHL*WCT 14 P+ C L+ +E PS QE+V S S VD+G E L C+ Sbjct: 817 PEGCILNLNEIPSWQEKVQHPSDMEVSGVDSGSKEQLRDCS 857
>AT8B1_HUMAN (O43520) Probable phospholipid-transporting ATPase IC (EC 3.6.3.1)| (Familial intrahepatic cholestasis type 1) (ATPase class I type 8B member 1) Length = 1251 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 114 CDKQQIFGDHRDPAQLNLTKV 176 C QI+GDHRD +Q N K+ Sbjct: 470 CINGQIYGDHRDASQHNHNKI 490 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,211,509 Number of Sequences: 219361 Number of extensions: 314516 Number of successful extensions: 808 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 808 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)