>GLR35_ARATH (Q9SW97) Glutamate receptor 3.5 precursor (Ligand-gated ion channel|
           3.5) (Ionotropic glutamate receptor GLR6)
          Length = 953

 Score = 29.6 bits (65), Expect = 4.1
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = -1

Query: 317 WSSFLLGFLCPLLWYYATTLYCCKYYNRDPRERP 216
           W  FL+   C ++W+ A TL+C K + +  R RP
Sbjct: 852 WGLFLI---CGVVWFIALTLFCWKVFWQYQRLRP 882


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 58,720,596
Number of Sequences: 219361
Number of extensions: 998139
Number of successful extensions: 2687
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2626
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2687
length of database: 80,573,946
effective HSP length: 103
effective length of database: 57,979,763
effective search space used: 3072927439
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)