| Clone Name | rbags1d15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TOC34_ARATH (Q38906) Translocase of chloroplast 34 (EC 3.6.5.-) ... | 79 | 2e-15 | 2 | TOC34_PEA (Q41009) Translocase of chloroplast 34 (EC 3.6.5.-) (3... | 70 | 9e-13 | 3 | HMDH1_GOSHI (O64966) 3-hydroxy-3-methylglutaryl-coenzyme A reduc... | 28 | 5.2 |
|---|
>TOC34_ARATH (Q38906) Translocase of chloroplast 34 (EC 3.6.5.-) (34 kDa| chloroplast outer envelope protein) (GTP-binding protein OEP34) (AtToc34) Length = 313 Score = 79.3 bits (194), Expect = 2e-15 Identities = 36/67 (53%), Positives = 45/67 (67%) Frame = -2 Query: 403 GTPWIPNLMKXITXVVSNGSRSIHVDXKLIXGPNPNNRXXXYIPLILAVQYFFVVKXIXR 224 GT WIPNL IT + NG+++IHVD KL+ GPNPN R IPL+ A QY V+K + R Sbjct: 228 GTSWIPNLFNKITEISFNGNKAIHVDKKLVEGPNPNERGKKLIPLMFAFQYLLVMKPLVR 287 Query: 223 XIHSDIS 203 I SD+S Sbjct: 288 AIKSDVS 294
>TOC34_PEA (Q41009) Translocase of chloroplast 34 (EC 3.6.5.-) (34 kDa| chloroplast outer envelope protein) (GTP-binding protein OEP34) (GTP-binding protein IAP34) Length = 310 Score = 70.5 bits (171), Expect = 9e-13 Identities = 35/67 (52%), Positives = 42/67 (62%) Frame = -2 Query: 403 GTPWIPNLMKXITXVVSNGSRSIHVDXKLIXGPNPNNRXXXYIPLILAVQYFFVVKXIXR 224 G WIP+L++ IT V N S SI VD LI GPNPN R +IPLI A+QY F+ K I Sbjct: 228 GIAWIPHLVQTITEVALNKSESIFVDKNLIDGPNPNQRGKLWIPLIFALQYLFLAKPIEA 287 Query: 223 XIHSDIS 203 I DI+ Sbjct: 288 LIRRDIA 294
>HMDH1_GOSHI (O64966) 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (EC| 1.1.1.34) (HMG-CoA reductase 1) Length = 585 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 81 MHSHWPXQALGLRDDXTXWSTGLPLP 158 + SH P + + L DD T S LPLP Sbjct: 12 IRSHKPARPIALEDDSTKASDALPLP 37 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,807,492 Number of Sequences: 219361 Number of extensions: 567967 Number of successful extensions: 755 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)