| Clone Name | rbags1d06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRI46_MOUSE (Q7TNM2) Tripartite motif protein 46 (Tripartite, fi... | 30 | 3.7 | 2 | TRI46_HUMAN (Q7Z4K8) Tripartite motif protein 46 (Tripartite, fi... | 30 | 3.7 |
|---|
>TRI46_MOUSE (Q7TNM2) Tripartite motif protein 46 (Tripartite, fibronectin| type-III and C-terminal SPRY motif protein) Length = 759 Score = 30.0 bits (66), Expect = 3.7 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 263 PPHDLAVWRYCRWWRSVKVPAAIAAVNGSPGPRRWR 370 PPH W Y +R VPA PGP RW+ Sbjct: 453 PPHSPPAWHYTVEFRRTDVPA-------QPGPTRWQ 481
>TRI46_HUMAN (Q7Z4K8) Tripartite motif protein 46 (Tripartite, fibronectin| type-III and C-terminal SPRY motif protein) Length = 759 Score = 30.0 bits (66), Expect = 3.7 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 263 PPHDLAVWRYCRWWRSVKVPAAIAAVNGSPGPRRWR 370 PPH W Y +R VPA PGP RW+ Sbjct: 453 PPHSPPAWHYTVEFRRTDVPA-------QPGPTRWQ 481 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,639,733 Number of Sequences: 219361 Number of extensions: 1226373 Number of successful extensions: 3335 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3335 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)