| Clone Name | rbags1c22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TYDP_CAEEL (Q9TXV7) Probable tyrosyl-DNA phosphodiesterase (EC 3... | 32 | 2.2 | 2 | DCAM_PEA (Q43820) S-adenosylmethionine decarboxylase proenzyme (... | 30 | 5.0 | 3 | OPGH_BRAJA (Q89BU5) Glucans biosynthesis glucosyltransferase H (... | 30 | 5.0 | 4 | ARAD_BACHD (Q9KBQ4) L-ribulose-5-phosphate 4-epimerase (EC 5.1.3... | 30 | 8.5 |
|---|
>TYDP_CAEEL (Q9TXV7) Probable tyrosyl-DNA phosphodiesterase (EC 3.1.4.-)| (Tyr-DNA phosphodiesterase) Length = 451 Score = 31.6 bits (70), Expect = 2.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 261 TRGCWIIDKCSLMGTLTKIPISWERGQ*HASEEPVN 154 T C + +CS +G+L PI+W RGQ S E N Sbjct: 255 TERCTFVAQCSSIGSLGSAPINWFRGQFLQSLEGAN 290
>DCAM_PEA (Q43820) S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50)| (AdoMetDC) (SamDC) [Contains: S-adenosylmethionine decarboxylase alpha chain; S-adenosylmethionine decarboxylase beta chain] Length = 353 Score = 30.4 bits (67), Expect = 5.0 Identities = 21/58 (36%), Positives = 27/58 (46%) Frame = -2 Query: 439 EIDVTAGFYVLFGSGLVLSFILAIYVLQSSQEKLTRFVREAVSDSSLPEGGVAKVE*C 266 E+ V GF+ GSG + Y+L S E + A SDS PEG V +E C Sbjct: 132 EVAVLDGFFGKLGSGSMA------YILGGSDEAQNWHIYCASSDSVSPEGSVYTLEMC 183
>OPGH_BRAJA (Q89BU5) Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)| Length = 748 Score = 30.4 bits (67), Expect = 5.0 Identities = 24/83 (28%), Positives = 40/83 (48%) Frame = -2 Query: 577 LGSLVANPSVFHWAVVELHPDIKKNFWDQQNWPKYVLVSYTWEEQSEIDVTAGFYVLFGS 398 +GS V P + +V L ++ +F + +PK + TW +Q + F G Sbjct: 444 IGSYVTAPLWLLFLLVGLLISLQAHFIRPEYFPKGFSLFPTWPQQDPVLAAWVFAATMGL 503 Query: 397 GLVLSFILAIYVLQSSQEKLTRF 329 L+L +LA VL S++E+ T F Sbjct: 504 -LILPKLLAYLVLISNREERTGF 525
>ARAD_BACHD (Q9KBQ4) L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4)| (Phosphoribulose isomerase) Length = 231 Score = 29.6 bits (65), Expect = 8.5 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 481 PKYVLVSYTWEEQSEIDVTAGFYVLFGSGL 392 PKY LV++TW S ID G V+ SG+ Sbjct: 17 PKYQLVTFTWGNVSGIDREKGLVVIKPSGV 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,701,534 Number of Sequences: 219361 Number of extensions: 2068434 Number of successful extensions: 4845 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4844 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6427774254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)