| Clone Name | rbah60n04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | F261_RAT (P07953) 6-phosphofructo-2-kinase/fructose-2,6-biphosph... | 30 | 9.1 | 2 | TM6S2_HUMAN (Q9BZW4) Transmembrane 6 superfamily member 2 (Fragm... | 30 | 9.1 | 3 | F263_RAT (O35552) 6-phosphofructo-2-kinase/fructose-2,6-biphosph... | 30 | 9.1 | 4 | F263_HUMAN (Q16875) 6-phosphofructo-2-kinase/fructose-2,6-biphos... | 30 | 9.1 |
|---|
>F261_RAT (P07953) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1| (6PF-2-K/Fru-2,6-P2ASE liver isozyme) [Includes: 6-phosphofructo-2-kinase (EC 2.7.1.105); Fructose-2,6-bisphosphatase (EC 3.1.3.46)] Length = 470 Score = 29.6 bits (65), Expect = 9.1 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +1 Query: 223 HASSSICLLASCGPHSSQFFWSAPTLAMM*GSSTQF-TYTYRVTQQQLNWLGFPTSTRFN 399 H+SSS L G QF ++PT+ +M G + TY + LNW+G PT FN Sbjct: 19 HSSSSSVLQRRRGSSIPQFT-NSPTMVIMVGLPARGKTYISTKLTRYLNWIGTPTKV-FN 76 Query: 400 M 402 + Sbjct: 77 L 77
>TM6S2_HUMAN (Q9BZW4) Transmembrane 6 superfamily member 2 (Fragment)| Length = 350 Score = 29.6 bits (65), Expect = 9.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 229 MRDPAGVASVQLLLYRV*MTPFASLEAYNL 140 +RDP VQ+L+Y + PF L AY L Sbjct: 257 LRDPVAYPKVQMLMYMFYVLPFCGLAAYAL 286
>F263_RAT (O35552) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3| (6PF-2-K/Fru-2,6-P2ASE brain-type isozyme) (RB2K) [Includes: 6-phosphofructo-2-kinase (EC 2.7.1.105); Fructose-2,6-bisphosphatase (EC 3.1.3.46)] Length = 555 Score = 29.6 bits (65), Expect = 9.1 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = +1 Query: 202 PKQHQPDHASSSICLLASCGPHSSQFFWSAPTLAMM*GSSTQF-TYTYRVTQQQLNWLGF 378 P H+P L SCGP + ++PT+ +M G + TY + + LNW+G Sbjct: 16 PVDHRPS-------LPRSCGPKLT----NSPTVIVMVGLPARGKTYISKKLTRYLNWIGV 64 Query: 379 PTSTRFNM 402 PT FN+ Sbjct: 65 PTKV-FNV 71
>F263_HUMAN (Q16875) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3| (6PF-2-K/Fru-2,6-P2ASE brain/placenta-type isozyme) (iPFK-2) (NY-REN-56 antigen) [Includes: 6-phosphofructo-2-kinase (EC 2.7.1.105); Fructose-2,6-bisphosphatase (EC 3.1.3.46)] Length = 520 Score = 29.6 bits (65), Expect = 9.1 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = +1 Query: 202 PKQHQPDHASSSICLLASCGPHSSQFFWSAPTLAMM*GSSTQF-TYTYRVTQQQLNWLGF 378 P H+P L SCGP + ++PT+ +M G + TY + + LNW+G Sbjct: 16 PVDHRPS-------LPRSCGPKLT----NSPTVIVMVGLPARGKTYISKKLTRYLNWIGV 64 Query: 379 PTSTRFNM 402 PT FN+ Sbjct: 65 PTKV-FNV 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 110,509,698 Number of Sequences: 219361 Number of extensions: 2462486 Number of successful extensions: 5289 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5287 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6856295237 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)