ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbah60m13 |
|---|---|
| Clone Library Name | barley_pub |
>UCRIA_WHEAT (Q7X9A6) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 222 Score = 72.0 bits (175), Expect = 4e-13 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWWK 109 LALVHADVDDGKVVFVPWV TDFRTG+NPWWK Sbjct: 191 LALVHADVDDGKVVFVPWVETDFRTGDNPWWK 222
>UCRIA_ORYSA (Q69S39) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 225 Score = 68.9 bits (167), Expect = 3e-12 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LALVHADVDDGKV+FVPWV TDFRTG+NPWW Sbjct: 194 LALVHADVDDGKVLFVPWVETDFRTGDNPWW 224
>UCRIA_TOBAC (P30361) Cytochrome b6-f complex iron-sulfur subunit 1, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein 1) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1) (ISP 1) (RISP 1) Length = 228 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL HAD+DDGKVVFVPWV TDFRTGE+PWW Sbjct: 197 LALAHADIDDGKVVFVPWVETDFRTGEDPWW 227
>UCRIA_SOLTU (Q69GY7) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 230 Score = 66.2 bits (160), Expect = 2e-11 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL HAD+DDGKVVFVPWV TDFRTG++PWW Sbjct: 199 LALAHADIDDGKVVFVPWVETDFRTGDSPWW 229
>UCRIB_TOBAC (Q02585) Cytochrome b6-f complex iron-sulfur subunit 2, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein 2) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2) (ISP 2) (RISP 2) Length = 228 Score = 66.2 bits (160), Expect = 2e-11 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL HAD+DDGKVVFVPWV TDFRTGE PWW Sbjct: 197 LALAHADIDDGKVVFVPWVETDFRTGEAPWW 227
>UCRIA_SPIOL (P08980) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 230 Score = 63.5 bits (153), Expect = 1e-10 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL H DVDDGKVVFVPW TDFRTGE PWW Sbjct: 198 LALAHCDVDDGKVVFVPWTETDFRTGEAPWW 228
>UCRIA_FRIAG (O49078) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 230 Score = 59.3 bits (142), Expect = 3e-09 Identities = 25/32 (78%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = -2 Query: 204 LALVHADV-DDGKVVFVPWVXTDFRTGENPWW 112 LAL H D+ ++GKVVFVPWV TDFRTGENPWW Sbjct: 198 LALSHCDISEEGKVVFVPWVETDFRTGENPWW 229
>UCRIA_ARATH (Q9ZR03) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) (Proton gradient regulation protein 1) Length = 229 Score = 57.8 bits (138), Expect = 8e-09 Identities = 24/32 (75%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = -2 Query: 204 LALVHADVDD-GKVVFVPWVXTDFRTGENPWW 112 LAL HAD+D+ GKV+FVPWV TDFRTG+ PWW Sbjct: 197 LALAHADIDEAGKVLFVPWVETDFRTGDAPWW 228
>UCRIA_PEA (P26291) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 230 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%), Gaps = 2/33 (6%) Frame = -2 Query: 204 LALVHADV--DDGKVVFVPWVXTDFRTGENPWW 112 LAL H DV +DGKVVFVPWV TDFRTG+ PWW Sbjct: 197 LALAHCDVGVEDGKVVFVPWVETDFRTGDAPWW 229
>UCRI_MASLA (P83794) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 179 Score = 51.6 bits (122), Expect = 6e-07 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL HA V D +V PW TDFRTGE PWW Sbjct: 148 LALCHATVQDDNIVLTPWTETDFRTGEKPWW 178
>UCRI_SYNP6 (Q5N5B0) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 179 Score = 51.2 bits (121), Expect = 7e-07 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL H V D KV PW TDFRTG+NPWW Sbjct: 148 LALAHVSVTDDKVFLSPWTETDFRTGDNPWW 178
>UCRIA_ANAVT (Q9L3P9) Cytochrome b6-f complex iron-sulfur subunit 1 (EC| 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 179 Score = 50.4 bits (119), Expect = 1e-06 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL HA ++ K+V PW TDFRTGE PWW Sbjct: 148 LALSHAKTENDKIVLTPWTETDFRTGEEPWW 178
>UCRIA_CHLS6 (Q7XYM4) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 252 Score = 50.1 bits (118), Expect = 2e-06 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 L L H + D+GK++ PW TDFRTGE PWW Sbjct: 221 LQLAHVEDDNGKILLSPWTETDFRTGEKPWW 251
>UCRI_PROMP (Q7V2L4) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 178 Score = 49.3 bits (116), Expect = 3e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL H DVDD V+ W TDFRT ENPWW Sbjct: 147 LALAHVDVDDDAVLVKQWSETDFRTNENPWW 177
>UCRI_NOSSP (P14698) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 179 Score = 48.9 bits (115), Expect = 4e-06 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL HA+ D K++ PW TDFRTG+ PWW Sbjct: 148 LALAHANTVDDKIILSPWTETDFRTGDAPWW 178
>UCRI_PROMA (Q7VDC0) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 178 Score = 48.5 bits (114), Expect = 5e-06 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL H D+DD V+ W TDFRTG+ PWW Sbjct: 147 LALTHIDIDDDNVLVSQWTETDFRTGDKPWW 177
>UCRIA_ANASP (Q93SX0) Cytochrome b6-f complex iron-sulfur subunit 1 (EC| 1.10.99.1) (Rieske iron-sulfur protein 1) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1) (ISP 1) (RISP 1) Length = 179 Score = 47.4 bits (111), Expect = 1e-05 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL HA ++ K+V W TDFRTGE PWW Sbjct: 148 LALSHAKTENDKIVLTSWTETDFRTGEEPWW 178
>UCRI_SYNP2 (P26292) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 180 Score = 46.2 bits (108), Expect = 2e-05 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -2 Query: 204 LALVHADV-DDGKVVFVPWVXTDFRTGENPWW 112 LALVHA+V +D K+ F W TDFRT E PWW Sbjct: 148 LALVHAEVTEDDKISFTDWTETDFRTDEAPWW 179
>UCRIB_CYAPA (Q5CC92) Cytochrome b6-f complex iron-sulfur subunit 2, cyanelle| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein 2) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2) (ISP 2) (RISP 2) Length = 241 Score = 46.2 bits (108), Expect = 2e-05 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -2 Query: 204 LALVHADV-DDGKVVFVPWVXTDFRTGENPWWK 109 LAL H +V +DG V F PW TDFRT PWWK Sbjct: 209 LALAHVNVLEDGVVAFEPWTETDFRTNTAPWWK 241
>UCRIA_CYAPA (Q5CC93) Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein 1) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1) (ISP 1) (RISP 1) Length = 239 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/33 (60%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -2 Query: 204 LALVHADV-DDGKVVFVPWVXTDFRTGENPWWK 109 LAL H V +DG V F PW TDFRT PWWK Sbjct: 207 LALAHVSVLEDGVVAFEPWTETDFRTNTAPWWK 239
>UCRI_SYNEL (Q9X9T2) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 180 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -2 Query: 204 LALVHADV-DDGKVVFVPWVXTDFRTGENPWW 112 LALV A V +D K+VF PW DFRTG+ PWW Sbjct: 148 LALVKATVTEDDKLVFTPWTEIDFRTGKEPWW 179
>UCRIA_VOLCA (Q9SBN3) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 206 Score = 44.7 bits (104), Expect = 7e-05 Identities = 20/32 (62%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -2 Query: 204 LALVHADV-DDGKVVFVPWVXTDFRTGENPWW 112 LAL H DV +DG V F W TDFRTG PWW Sbjct: 174 LALAHCDVQEDGLVTFSTWSETDFRTGLEPWW 205
>UCRIB_SYNY3 (P26290) Cytochrome b6-f complex iron-sulfur subunit 2 (EC| 1.10.99.1) (Rieske iron-sulfur protein 2) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2) (ISP 2) (RISP 2) Length = 180 Score = 44.7 bits (104), Expect = 7e-05 Identities = 20/32 (62%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -2 Query: 204 LALVHADV-DDGKVVFVPWVXTDFRTGENPWW 112 LAL HA V DD K+V W TDFRT E+PWW Sbjct: 148 LALAHATVTDDDKLVLSTWTETDFRTDEDPWW 179
>UCRIA_CHLRE (P49728) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 206 Score = 43.1 bits (100), Expect = 2e-04 Identities = 19/32 (59%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 204 LALVHADV-DDGKVVFVPWVXTDFRTGENPWW 112 LAL H DV + G V F W TDFRTG PWW Sbjct: 174 LALAHCDVAESGLVTFSTWTETDFRTGLEPWW 205
>UCRI_SYNPX (Q7U566) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 178 Score = 40.0 bits (92), Expect = 0.002 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL + V++ V W TDFRTG+ PWW Sbjct: 147 LALANVSVENDNVFVSQWTETDFRTGDKPWW 177
>UCRI_PROMM (Q7V654) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 178 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 LAL + V++ V W TDFRTGE PWW Sbjct: 147 LALANIAVENDNVFVSQWTETDFRTGEKPWW 177
>UCRIB_ANAVT (Q93SW6) Cytochrome b6-f complex iron-sulfur subunit 2 (EC| 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 178 Score = 38.1 bits (87), Expect = 0.006 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 L LVH V D + W TD RTGE PWW Sbjct: 147 LKLVHVQVKDDYIWISSWQETDPRTGEKPWW 177
>UCRIB_ANASP (Q93SW8) Cytochrome b6-f complex iron-sulfur subunit 2 (EC| 1.10.99.1) (Rieske iron-sulfur protein 2) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2) (ISP 2) (RISP 2) Length = 178 Score = 38.1 bits (87), Expect = 0.006 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 L LV V D + PW TD RTGE PWW Sbjct: 147 LKLVQVQVKDDYIWISPWQETDPRTGEKPWW 177
>UCRIC_ANASP (P70758) Cytochrome b6-f complex iron-sulfur subunit 3 (EC| 1.10.99.1) (Rieske iron-sulfur protein 3) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 3) (ISP 3) (RISP 3) Length = 178 Score = 37.7 bits (86), Expect = 0.008 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 L +V V D ++ PW TD RTG+ PWW Sbjct: 147 LKIVQVAVIDNSILISPWTETDPRTGKKPWW 177
>UCRIA_SYNY3 (P74714) Cytochrome b6-f complex iron-sulfur subunit 1 (EC| 1.10.99.1) (Rieske iron-sulfur protein 1) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1) (ISP 1) (RISP 1) Length = 178 Score = 36.2 bits (82), Expect = 0.024 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFRTGENPWW 112 L +V V D ++ PW D RTGE PWW Sbjct: 147 LKIVQVAVVDDQIFISPWTDLDPRTGEKPWW 177
>UCRI_GLOVI (Q7NCE1) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 186 Score = 33.5 bits (75), Expect = 0.16 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 5/36 (13%) Frame = -2 Query: 204 LALVHADVDDGKVVFVPWVXTDFR-----TGENPWW 112 LALV A V D KV+ PW DFR ++P+W Sbjct: 149 LALVKATVSDDKVLIAPWTEQDFRCTDLWCNKDPYW 184
>TRIB1_HUMAN (Q96RU8) Tribbles homolog 1 (TRB-1) (SKIP1) (G-protein-coupled| receptor induced protein 2) (GIG-2) Length = 372 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 91 RSLCRLFPPRVLAGPEVGLHPWHEDXL 171 RSL R P L PE+ LHPW E L Sbjct: 316 RSLLRREPSERLTAPEILLHPWFESVL 342
>VE2_HPV25 (P36787) Regulatory protein E2| Length = 502 Score = 28.9 bits (63), Expect = 3.9 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 Query: 200 PSFTQTSTTARXSSCHGXRPTSGPARTRGGNKRHKLRQ 87 PS T ++T+ R +S R RGG +RH+L + Sbjct: 333 PSTTSSATSQRSQRSRSRAGSSRGGRGRGGRRRHRLSE 370
>DHE2_YEAST (P33327) NAD-specific glutamate dehydrogenase (EC 1.4.1.2)| (NAD-GDH) Length = 1092 Score = 28.1 bits (61), Expect = 6.6 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -2 Query: 180 DDGKVVFVPWVXTDFRTGENPWWK 109 D+G FV W R PWWK Sbjct: 680 DEGTAGFVDWATNHARVRNCPWWK 703
>TRIB1_MOUSE (Q8K4K4) Tribbles homolog 1 (TRB-1)| Length = 372 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 91 RSLCRLFPPRVLAGPEVGLHPWHE 162 RSL R P L P++ LHPW E Sbjct: 316 RSLLRREPSERLTAPQILLHPWFE 339 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,037,084 Number of Sequences: 219361 Number of extensions: 335008 Number of successful extensions: 998 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 997 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
