| Clone Name | rbah60k15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SEY1_YARLI (Q6C3B0) Protein SEY1 | 30 | 7.3 | 2 | CPXC_AGRTU (P24466) Cytochrome P450-pinF1, plant-inducible (EC 1... | 30 | 7.3 | 3 | ROBO3_HUMAN (Q96MS0) Roundabout homolog 3 precursor (Roundabout-... | 30 | 9.5 |
|---|
>SEY1_YARLI (Q6C3B0) Protein SEY1| Length = 938 Score = 30.0 bits (66), Expect = 7.3 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -2 Query: 610 ASKKLPAMSPSILGSPSPATTSFVPCIQKTRRLT 509 A K +PA SP +P+PA + VP QK+ + T Sbjct: 123 AEKSIPASSPVHKAAPTPAASHAVPTSQKSAKST 156
>CPXC_AGRTU (P24466) Cytochrome P450-pinF1, plant-inducible (EC 1.14.-.-)| Length = 422 Score = 30.0 bits (66), Expect = 7.3 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 607 SKKLPAMS-PSILGSPSPATTSFVPCIQKTRRLTSVVWRD 491 + +LPA++ S+LG PS T F + K R S WRD Sbjct: 158 ASQLPALTIASVLGLPSEDTPFFTRLVYKVSRCLSPSWRD 197
>ROBO3_HUMAN (Q96MS0) Roundabout homolog 3 precursor (Roundabout-like protein 3)| Length = 1386 Score = 29.6 bits (65), Expect = 9.5 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -2 Query: 682 RSPLVGSLVANTSRSSLGVL-ARVAASKKLPAMSPSILGSPSPATTSFVP 536 R PL S + S+ LG+ AR A PA SP + SP+P+T S P Sbjct: 1179 RVPLGPSSPLSVSQPMLGIREARPAGLGAGPAASPHLSPSPAPSTASSAP 1228 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,782,079 Number of Sequences: 219361 Number of extensions: 1909056 Number of successful extensions: 5245 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5245 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7196276819 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)