| Clone Name | rbah60k14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IL6RB_RAT (P40190) Interleukin-6 receptor beta chain precursor (... | 32 | 1.9 | 2 | MNT_MOUSE (O08789) Max-binding protein MNT (Protein ROX) (Myc an... | 30 | 4.3 | 3 | MSH5_RAT (Q6MG62) MutS protein homolog 5 | 30 | 5.7 | 4 | OR7A5_HUMAN (Q15622) Olfactory receptor 7A5 (Olfactory receptor ... | 29 | 9.7 |
|---|
>IL6RB_RAT (P40190) Interleukin-6 receptor beta chain precursor (IL-6R-beta)| (Interleukin 6 signal transducer) (Membrane glycoprotein 130) (gp130) (CD130 antigen) Length = 918 Score = 31.6 bits (70), Expect = 1.9 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Frame = +1 Query: 304 DTIILVH-----QESPETSMEFTMYAKRGATTSVHRAMSPFMCGFILTTLMSGLWCGRSR 468 DT+ +VH +E + EFT + A + + P F+LTTL+ L+C R Sbjct: 584 DTLYMVHMAAYTEEGGKDGPEFTFTTLKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKR 643
>MNT_MOUSE (O08789) Max-binding protein MNT (Protein ROX) (Myc antagonist MNT)| Length = 591 Score = 30.4 bits (67), Expect = 4.3 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +2 Query: 497 QPPACRTE---PHPRPATPRLMCVPSPVEVEAMSCGAALPPVH 616 QPP +T P P PATP VP+PV + A + G + H Sbjct: 404 QPPQQKTPLPGPPPPPATPTQTLVPAPVHLVATAGGGSTVIAH 446
>MSH5_RAT (Q6MG62) MutS protein homolog 5| Length = 831 Score = 30.0 bits (66), Expect = 5.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = -1 Query: 461 RPHHSPLISVVKMKPHMKGLIALCTLVVAPLFAYMVNSMDVSGLSWCTRIMVSCGVSGAL 282 RPH+SP I V++K L+ LC P NS D G +++ SG Sbjct: 543 RPHYSPCIQGVRIKNGRHPLMELCARTFVP------NSTDCGGDQGRVKVITGPNSSGKS 596 Query: 281 TY 276 Y Sbjct: 597 IY 598
>OR7A5_HUMAN (Q15622) Olfactory receptor 7A5 (Olfactory receptor TPCR92)| Length = 319 Score = 29.3 bits (64), Expect = 9.7 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -1 Query: 446 PLISVVKMKPHMKGLIALCTLVVAPLFAYMVNSMDVSGLSWCTRIMV 306 PL +V M PH+ GL+ L + ++ L++ ++ + V LS+CT + + Sbjct: 129 PLHYMVIMNPHLCGLLVLASWTMSALYS-LLQILMVVRLSFCTALEI 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,575,289 Number of Sequences: 219361 Number of extensions: 2048649 Number of successful extensions: 5705 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5694 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)