| Clone Name | rbah60c17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TFR1_CRIGR (Q07891) Transferrin receptor protein 1 (TfR1) (TR) (... | 32 | 1.9 | 2 | TFR1_RAT (Q99376) Transferrin receptor protein 1 (TfR1) (TR) (Tf... | 32 | 2.5 | 3 | ALDH4_YEAST (P46367) Potassium-activated aldehyde dehydrogenase,... | 30 | 9.4 |
|---|
>TFR1_CRIGR (Q07891) Transferrin receptor protein 1 (TfR1) (TR) (TfR) (Trfr)| Length = 757 Score = 32.0 bits (71), Expect = 1.9 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = -1 Query: 380 YNLNYSALSWTKLPSDLLFGLPSMPIRIKSFPTLLQVIRRARPRCPPSNPDDRTC 216 Y + + + T+ P GLPS+P++ S ++ + CPPS D C Sbjct: 306 YTPGFPSFNHTQFPPSQSSGLPSIPVQTISRKAAEKLFQNMETNCPPSWNTDSLC 360
>TFR1_RAT (Q99376) Transferrin receptor protein 1 (TfR1) (TR) (TfR) (Trfr)| (Fragment) Length = 622 Score = 31.6 bits (70), Expect = 2.5 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = -1 Query: 380 YNLNYSALSWTKLPSDLLFGLPSMPIRIKSFPTLLQVIRRARPRCPPSNPDDRTC 216 Y + + + T+ P GLPS+P++ S ++ + CPPS D +C Sbjct: 171 YTPGFPSFNHTQFPPSQSSGLPSIPVQTISRAPAEKLFKNMEGNCPPSWNIDSSC 225
>ALDH4_YEAST (P46367) Potassium-activated aldehyde dehydrogenase, mitochondrial| precursor (EC 1.2.1.3) (K(+)-activated acetaldehyde dehydrogenase) (K(+)-ACDH) Length = 519 Score = 29.6 bits (65), Expect = 9.4 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = -2 Query: 682 SGRRRLTLDLGGASAPI*LDDAEHKSSILVVAAAAHYDS 566 +G +++TL+LGG S I DAE K ++ + +Y+S Sbjct: 282 AGLKKVTLELGGKSPNIVFADAELKKAVQNIILGIYYNS 320 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 105,282,318 Number of Sequences: 219361 Number of extensions: 2216477 Number of successful extensions: 4845 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4845 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7139613222 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)