| Clone Name | rbah60b23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CEP35_HUMAN (Q5VT06) Centrosome-associated protein 350 (Centroso... | 30 | 2.1 | 2 | GCX1_HUMAN (Q96NM4) Granulosa cell HMG box protein 1 (GCX-1) | 28 | 6.0 | 3 | SIF2_SCHPO (O74446) Sad1-interacting factor 2 | 28 | 7.8 | 4 | SAPS1_MOUSE (Q7TSI3) SAPS domain family member 1 | 28 | 7.8 |
|---|
>CEP35_HUMAN (Q5VT06) Centrosome-associated protein 350 (Centrosome-associated| protein of 350 kDa) Length = 3117 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 132 SRQSAHRDDPSRDQECTPPGHXDGETR 212 S+ +H DD ++D + T PG D ETR Sbjct: 1801 SKLDSHSDDDTKDNKATSPGPTDLETR 1827
>GCX1_HUMAN (Q96NM4) Granulosa cell HMG box protein 1 (GCX-1)| Length = 488 Score = 28.1 bits (61), Expect = 6.0 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Frame = +1 Query: 142 AHTATTPPGTRSAPPRXXSM---EKRECFARRNAVRVHAPRPGKRASS 276 AH++ +PPG++SA P S E+ E + + + + PGK+A + Sbjct: 196 AHSSPSPPGSKSATPSPSSSTQEEESEVHFKISGEKRPSADPGKKAKN 243
>SIF2_SCHPO (O74446) Sad1-interacting factor 2| Length = 446 Score = 27.7 bits (60), Expect = 7.8 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +3 Query: 123 FLSSRQSAHRDDPSRDQEC--TPPGHXDGETRVLCTPERRQSTRAEARXES 269 F SR+S+H+ P + EC +P + + ET L P+ +S+R ES Sbjct: 85 FFQSRRSSHKTRPKQFDECIYSPYSYNNEETTDL-LPDTLESSRGTLNRES 134
>SAPS1_MOUSE (Q7TSI3) SAPS domain family member 1| Length = 856 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 109 HNAFSFSPPVRAHTATTPPGTRSAPPRXXSMEKRE 213 + A+ S PVRA A+ PPG RS E E Sbjct: 640 YGAWQGSQPVRASQASQPPGVRSGGSTDSEEEDEE 674 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,535,770 Number of Sequences: 219361 Number of extensions: 563592 Number of successful extensions: 1842 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1840 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)