| Clone Name | rbah60b19 |
|---|---|
| Clone Library Name | barley_pub |
>PUSH_ARATH (O22928) Putative tRNA pseudouridine synthase (EC 5.4.99.-)| (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 510 Score = 76.6 bits (187), Expect = 4e-14 Identities = 30/69 (43%), Positives = 48/69 (69%) Frame = -3 Query: 529 RPGMQSINESEEIKKGVMEFYKVALVPELAKFLDESLPPWQEWVENLDHFTSIPDSQLDE 350 RPGM++ ESEE++K + EFY+ +VP+++ FLD PW+EWV++LD + D +L++ Sbjct: 413 RPGMEATGESEEVEKEIEEFYRAVMVPQVSIFLDSEKSPWKEWVDHLDRNDGLIDEELED 472 Query: 349 VRTAYRAWK 323 VR + WK Sbjct: 473 VRKGWEEWK 481
>DDC_MANSE (P48861) Aromatic-L-amino-acid decarboxylase (EC 4.1.1.28) (AADC)| (DOPA decarboxylase) (DDC) Length = 508 Score = 32.7 bits (73), Expect = 0.72 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 3/57 (5%) Frame = -3 Query: 364 SQLDEVRTAYRAWKDDYDRVKMARKNTGSG*YVFIKLI---TKRTRN*TTYPESNVF 203 S+ E + +W++ DR+ M K+ G+ V IK+I T+RT+N TY + N+F Sbjct: 450 SRFTEESDMHVSWEEIKDRLMMFLKSKGA---VLIKIICSTTRRTKNILTYIKQNIF 503
>GLTB_AZOBR (Q05755) Glutamate synthase [NADPH] large chain precursor (EC| 1.4.1.13) (Glutamate synthase alpha subunit) (NADPH-GOGAT) (GLTS alpha chain) Length = 1515 Score = 30.4 bits (67), Expect = 3.6 Identities = 30/95 (31%), Positives = 44/95 (46%), Gaps = 12/95 (12%) Frame = -3 Query: 523 GMQSINESEEIKKGVM---EFYKVALVP-------ELAKFLDESLPPWQEWVENLDHFTS 374 GM I+E++ I+KG + E V L EL L +L PW +WV+N H Sbjct: 406 GMVKIDETQVIEKGRLGPGEMIAVDLQSGKLYRDRELKDHL-ATLKPWDKWVQNTTH--- 461 Query: 373 IPDSQLDE-VRTA-YRAWKDDYDRVKMARKNTGSG 275 LDE V+TA + D D+ ++ R+ G Sbjct: 462 -----LDELVKTASLKGEPSDMDKAELRRRQQAFG 491
>STAT_ANOGA (Q7QDU4) Signal transducer and transcription activator (Ag-STAT)| Length = 722 Score = 30.4 bits (67), Expect = 3.6 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 5/62 (8%) Frame = -3 Query: 559 CTRXKQGSIVRPGMQSINESEEI-----KKGVMEFYKVALVPELAKFLDESLPPWQEWVE 395 C KQ S+V ++I ++EE+ K + E+ K + PE+ SL Q W E Sbjct: 181 CYSLKQRSLVDAFQKTIRKAEEVLNLVYNKYIFEWQKTQMFPEVRSTNAYSLDEIQTWYE 240 Query: 394 NL 389 +L Sbjct: 241 SL 242
>CAC1E_RABIT (Q02343) Voltage-dependent R-type calcium channel alpha-1E subunit| (Voltage-gated calcium channel alpha subunit Cav2.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 6) (Brain calcium channel II) (BII) Length = 2259 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 409 QEWVENLDHFTSIP-DSQLDEVRTAYRAWKDDYDRVKMARKNTGSG 275 +E VEN F + Q++ YRAW D + V +A +N SG Sbjct: 358 RERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSG 403
>CAC1E_RAT (Q07652) Voltage-dependent R-type calcium channel alpha-1E subunit| (Voltage-gated calcium channel alpha subunit Cav2.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 6) (RBE-II) (RBE2) (Brain calcium channel II) (BII) Length = 2222 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 409 QEWVENLDHFTSIP-DSQLDEVRTAYRAWKDDYDRVKMARKNTGSG 275 +E VEN F + Q++ YRAW D + V +A +N SG Sbjct: 309 RERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSG 354
>SPE1_PEA (Q43075) Arginine decarboxylase (EC 4.1.1.19) (ARGDC) (ADC)| Length = 728 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Frame = -3 Query: 499 EEIKKGVMEFYKVALVPELAKFLDESL---PPWQEWVENLDHFTSIPD 365 EE K+G + ++A V L + E++ P +++ NL FTS+PD Sbjct: 474 EEFKQGTLGIEQLAAVDGLCDLITETIGVKDPVKKYHVNLSVFTSVPD 521
>SYE1_ZYMMO (Q5NP36) Glutamyl-tRNA synthetase 1 (EC 6.1.1.17) (Glutamate--tRNA| ligase 1) (GluRS 1) Length = 444 Score = 29.3 bits (64), Expect = 7.9 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 11/60 (18%) Frame = -3 Query: 535 IVRPGMQSINES--------EEIKKGVMEFYKVALVPE---LAKFLDESLPPWQEWVENL 389 ++RP + ++E+ E+I K + A + E +AK LD S PW+EW++ L Sbjct: 336 VIRPNIDDLSEAAFWWSVVKEDIAKPDLSAEDKAYLVEAMAIAKTLDWSSNPWKEWIDIL 395
>CAC1E_MOUSE (Q61290) Voltage-dependent R-type calcium channel alpha-1E subunit| (Voltage-gated calcium channel alpha subunit Cav2.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 6) (Brain calcium channel II) (BII) Length = 2272 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 409 QEWVENLDHFTSIP-DSQLDEVRTAYRAWKDDYDRVKMARKNTGSG 275 +E VEN F + Q++ YRAW D + V +A +N SG Sbjct: 359 RERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSG 404 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,080,442 Number of Sequences: 219361 Number of extensions: 1722951 Number of successful extensions: 4389 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4386 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)