| Clone Name | rbah59n22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DRP1A_ARATH (P42697) Dynamin-related protein 1A (Dynamin-like pr... | 32 | 0.56 | 2 | DRP1B_ARATH (Q84XF3) Dynamin-related protein 1B (Dynamin-like pr... | 30 | 2.1 | 3 | YCF1_OENBE (P31563) Hypothetical protein ycf1 (ORF 1005) (Fragment) | 29 | 2.8 | 4 | PIGF_MOUSE (O09101) Phosphatidylinositol-glycan biosynthesis, cl... | 28 | 6.2 |
|---|
>DRP1A_ARATH (P42697) Dynamin-related protein 1A (Dynamin-like protein A)| (Dynamin-like protein 1) Length = 610 Score = 31.6 bits (70), Expect = 0.56 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 252 LYRSAQAEIDTVAWSK 205 LYR+AQ+EID VAWSK Sbjct: 595 LYRAAQSEIDAVAWSK 610
>DRP1B_ARATH (Q84XF3) Dynamin-related protein 1B (Dynamin-like protein B)| Length = 610 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 252 LYRSAQAEIDTVAWSK 205 LYRSAQ +I+ VAWSK Sbjct: 595 LYRSAQTDIEAVAWSK 610
>YCF1_OENBE (P31563) Hypothetical protein ycf1 (ORF 1005) (Fragment)| Length = 1005 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +2 Query: 104 ESAIYDPQAKGRDVTKQGVKVN-THXGXISPHXFIFDHATVSISAWALRYS 253 +S + + + K ++ +GVK N T I+PH FD AT+ ++A YS Sbjct: 837 KSKLNEVKRKQNEIYPKGVKFNATPKTEINPHGIRFDAATIEKYSFATGYS 887
>PIGF_MOUSE (O09101) Phosphatidylinositol-glycan biosynthesis, class F protein| (PIG-F) Length = 219 Score = 28.1 bits (61), Expect = 6.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 78 SH*MTXALRCAICIVTXCYLV 16 SH +T AL+C +C + C+L+ Sbjct: 74 SHKVTRALKCCVCFLMSCFLL 94 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,857,974 Number of Sequences: 219361 Number of extensions: 551142 Number of successful extensions: 711 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 711 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)