| Clone Name | rbah59n16 |
|---|---|
| Clone Library Name | barley_pub |
>QORL_ARATH (Q9ZUC1) Quinone oxidoreductase-like protein At1g23740, chloroplast| precursor (EC 1.-.-.-) Length = 386 Score = 85.5 bits (210), Expect = 3e-17 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = -2 Query: 292 VTSXGSVLAKLXPYLESGKVKPVVDXKGPFPXXQVVEAFSYLETGRAAGKVVISPVP 122 VTS G VL KL PY+ESGKVKPVVD KGPFP +V +AFSYLET A GKVV+ P+P Sbjct: 330 VTSNGDVLKKLNPYIESGKVKPVVDPKGPFPFSRVADAFSYLETNHATGKVVVYPIP 386
>RT4I1_BRARE (Q7T3C7) Reticulon-4-interacting protein 1 homolog, mitochondrial| precursor Length = 387 Score = 40.8 bits (94), Expect = 9e-04 Identities = 22/50 (44%), Positives = 31/50 (62%) Frame = -2 Query: 280 GSVLAKLXPYLESGKVKPVVDXKGPFPXXQVVEAFSYLETGRAAGKVVIS 131 GS L ++ +++GKV+PVV+ F QV EAF +E G A GK V+S Sbjct: 333 GSALDEVSEMVDAGKVRPVVEE--VFSFAQVPEAFQKVEQGHARGKTVVS 380
>RT4I1_MOUSE (Q924D0) Reticulon-4-interacting protein 1, mitochondrial precursor| (NOGO-interacting mitochondrial protein) Length = 396 Score = 39.7 bits (91), Expect = 0.002 Identities = 19/54 (35%), Positives = 33/54 (61%) Frame = -2 Query: 286 SXGSVLAKLXPYLESGKVKPVVDXKGPFPXXQVVEAFSYLETGRAAGKVVISPV 125 + G L ++ +++GK++PV++ FP +V EAF +E G A GK V++ V Sbjct: 345 ASGPYLDEIAELVDAGKIRPVIERT--FPFSEVPEAFLKVERGHARGKTVVNVV 396
>RT4I1_HUMAN (Q8WWV3) Reticulon-4-interacting protein 1, mitochondrial precursor| (NOGO-interacting mitochondrial protein) Length = 396 Score = 38.9 bits (89), Expect = 0.003 Identities = 20/54 (37%), Positives = 32/54 (59%) Frame = -2 Query: 286 SXGSVLAKLXPYLESGKVKPVVDXKGPFPXXQVVEAFSYLETGRAAGKVVISPV 125 + G L + +++GK++PV++ FP +V EAF +E G A GK VI+ V Sbjct: 345 ASGPCLDDIAELVDAGKIRPVIEQT--FPFSKVPEAFLKVERGHARGKTVINVV 396
>VAT1_HUMAN (Q99536) Synaptic vesicle membrane protein VAT-1 homolog (EC| 1.-.-.-) Length = 393 Score = 31.6 bits (70), Expect = 0.54 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -2 Query: 274 VLAKLXPYLESGKVKPVVDXKGPFPXXQVVEAFSYLETGRAAGKVVISPVP 122 V+A+L G +KP +D PF +V +A ++ + GKV++ P P Sbjct: 341 VVARLLALYNQGHIKPHIDSVWPF--EKVADAMKQMQEKKNVGKVLLVPGP 389
>QOR_LEIAM (P42865) Probable quinone oxidoreductase (EC 1.6.5.5)| (NADPH:quinone reductase) (P36) Length = 340 Score = 31.6 bits (70), Expect = 0.54 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = -2 Query: 271 LAKLXPYLESGKVKPVVDXKGPFPXXQVVEAFSYLETGRAAGKVVI 134 +A L YL++G+VK VD K V +A +L +G GKV++ Sbjct: 292 MANLLQYLKAGQVKLFVDKKVFHGLSSVADAVDHLYSGANYGKVLV 337
>VAT1_MOUSE (Q62465) Synaptic vesicle membrane protein VAT-1 homolog (EC| 1.-.-.-) Length = 406 Score = 31.2 bits (69), Expect = 0.70 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = -2 Query: 277 SVLAKLXPYLESGKVKPVVDXKGPFPXXQVVEAFSYLETGRAAGKVVISPVP 122 SV+ +L G +KP +D PF +V +A ++ + GKV++ P P Sbjct: 353 SVVTRLVALYNQGHIKPRIDSVWPF--EKVADAMKQMQEKKNIGKVLLVPGP 402
>LIPB1_HUMAN (Q86W92) Liprin-beta-1 (Protein tyrosine phosphatase receptor type| f polypeptide-interacting protein-binding protein 1) (PTPRF-interacting protein-binding protein 1) (hSGT2) Length = 1011 Score = 31.2 bits (69), Expect = 0.70 Identities = 19/62 (30%), Positives = 28/62 (45%) Frame = +2 Query: 68 WQKHTTCAWLLAIYSGVSWNRRNDHFAGGSSCLEVGKRLHDLGXGERPLGVDHRLHLPGL 247 W K C WL+ G N A G + L+ ++ DL E+ LG+ H LH L Sbjct: 647 WTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQ--DL---EKELGIKHSLHRKKL 701 Query: 248 EV 253 ++ Sbjct: 702 QL 703
>AST1_YEAST (P35183) Protein AST1| Length = 429 Score = 30.8 bits (68), Expect = 0.92 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = -2 Query: 253 YLESGKVKPVVDXKGPFPXXQVVEAFSYLETGRAAGKVVIS 131 +L++G VK VVD + + EAFSY+ T RA GK++++ Sbjct: 387 FLKNGTVKCVVDKVYDWKDHK--EAFSYMATQRAQGKLIMN 425
>FAS_MOUSE (P19096) Fatty acid synthase (EC 2.3.1.85) [Includes:| [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41); 3-oxoacyl-[acyl- Length = 2504 Score = 30.8 bits (68), Expect = 0.92 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = -2 Query: 274 VLAKLXPYLESGKVKPVVDXKGPFPXXQVVEAFSYLETGRAAGKVVI 134 V A L + G VKP+ FP QV +AF Y+ G+ GKV++ Sbjct: 1803 VAALLKAGIRDGVVKPLKCTV--FPKAQVEDAFRYMAQGKHIGKVLV 1847
>QORH_ARATH (Q9SV68) Putative chloroplastic quinone-oxidoreductase homolog (EC| 1.-.-.-) Length = 329 Score = 30.8 bits (68), Expect = 0.92 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 250 LESGKVKPVVDXKGPFPXXQVVEAFSYLETGRAAGKVVISP 128 ++ GKVK V+D K P + +A++ G A GK+++ P Sbjct: 291 VKEGKVKTVIDSKHPLSKAE--DAWAKSIDGHATGKIIVEP 329
>FAS_RAT (P12785) Fatty acid synthase (EC 2.3.1.85) [Includes:| [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41); 3-oxoacyl-[acyl-ca Length = 2505 Score = 29.3 bits (64), Expect = 2.7 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 250 LESGKVKPVVDXKGPFPXXQVVEAFSYLETGRAAGKVVI 134 + G VKP+ FP QV +AF Y+ G+ GKV++ Sbjct: 1812 IRDGVVKPLKCTV--FPKAQVEDAFRYMAQGKHIGKVLV 1848
>FAS_BOVIN (Q71SP7) Fatty acid synthase (EC 2.3.1.85) [Includes:| [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41); 3-oxoacyl-[acyl- Length = 2513 Score = 29.3 bits (64), Expect = 2.7 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 250 LESGKVKPVVDXKGPFPXXQVVEAFSYLETGRAAGKVVI 134 + G V+P+ + FP Q +AF Y+ G+ GKVVI Sbjct: 1820 IRKGVVQPL--KRTVFPRTQAEDAFRYMAQGKHIGKVVI 1856
>ASPM_MOUSE (Q8CJ27) Abnormal spindle-like microcephaly-associated protein| homolog (Calmodulin-binding protein 1) (Spindle and hydroxyurea checkpoint abnormal protein) (Calmodulin-binding protein Sha1) Length = 3122 Score = 28.9 bits (63), Expect = 3.5 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +2 Query: 53 LLSNPWQKHTTCAWLL-AIYSGVSWNRRNDH 142 LL +K T+CA + A++ G SW ++NDH Sbjct: 2841 LLCRRQEKITSCATRIQALWRGYSWRKKNDH 2871
>POLG_FMDVI (P03310) Genome polyprotein [Contains: Coat protein VP1; Core| protein P52] (Fragment) Length = 234 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 111 AVSHGTGEMTTLPAALPVSR*ENASTTWXXGKGPL 215 AV+H TG++T +P PVS +N + KGPL Sbjct: 89 AVTH-TGKLTWVPNGAPVSALDNTANPTAYHKGPL 122
>POLG_FMDVT (P15072) Genome polyprotein [Contains: Leader protease (EC| 3.4.22.46) (P20A); Coat protein VP4; Coat protein VP2; Coat protein VP3; Coat protein VP1; Core protein P12] (Fragment) Length = 1011 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 111 AVSHGTGEMTTLPAALPVSR*ENASTTWXXGKGPL 215 AV+H TG++T +P PVS +N + KGPL Sbjct: 802 AVTH-TGKLTWVPNGAPVSALDNTTNPTAYHKGPL 835
>CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22| Length = 1010 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 228 RWSTPRGLSPSPRSWRRFPTSRQEEPPAK 142 R S+PR SP PR R P R + PP + Sbjct: 114 RSSSPRARSPPPRRHSRSPPLRGQPPPPR 142
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -3 Query: 222 STPRGLSPSPRSWRRFPTSRQEEPP 148 S PR SPSP RR P+ R+ PP Sbjct: 568 SLPRRRSPSPPPRRRSPSPRRYSPP 592 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,124,764 Number of Sequences: 219361 Number of extensions: 747544 Number of successful extensions: 2039 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2037 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)