| Clone Name | rbah59n08 |
|---|---|
| Clone Library Name | barley_pub |
>PYRC_METKA (Q8TXX9) Dihydroorotase (EC 3.5.2.3) (DHOase)| Length = 426 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 187 DVNAMPWECVPVIVQYWMPDGPM*ICHKQ 101 D A+PW +P I + PDGP+ I H + Sbjct: 154 DAPAVPWSTLPEIFRELSPDGPLTIFHPE 182
>I18BP_MOUSE (Q9Z0M9) Interleukin-18-binding protein precursor (IL-18BP)| (Interferon gamma-inducing factor-binding protein) Length = 191 Score = 29.6 bits (65), Expect = 2.1 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -2 Query: 197 SSDRCECNAMGVRTRYCPVLDAGWPDVNLP*AIEPFFLHHFLTRNCTA 54 S D C + V T+ P LD WP+ +P L+ LT +CTA Sbjct: 41 SKDPCSSWSPAVPTKQYPALDVIWPEKEVP-------LNGTLTLSCTA 81
>ACON_SCHPO (O13966) Aconitate hydratase, mitochondrial precursor (EC 4.2.1.3)| (Citrate hydro-lyase) (Aconitase) Length = 778 Score = 28.5 bits (62), Expect = 4.7 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -2 Query: 239 PVNSDIYPR-TYIKISSDRCECNAMGVRTRYCPVLDAGWPDVNLP 108 PVN DI +Y+K+ DR C + + AG P+V +P Sbjct: 73 PVNQDIERGVSYLKLRPDRVACQDATAQMAILQFMSAGMPEVAVP 117
>SCRA_LIMPO (Q25390) Alpha-scruin| Length = 918 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -3 Query: 211 HISRYRPI--DVNAMPWECVPVIVQYWMPD 128 +IS YRP+ D + + E VPV + +W PD Sbjct: 478 YISGYRPLPPDQDDLSKELVPVSIPFWPPD 507
>ADRO_HUMAN (P22570) NADPH:adrenodoxin oxidoreductase, mitochondrial precursor| (EC 1.18.1.2) (Adrenodoxin reductase) (AR) (Ferredoxin reductase) (Ferredoxin--NADP(+) reductase) Length = 491 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -2 Query: 134 AGWPDVNLP*A-IEPFFLHHFLTRNCTAM*CII 39 + WP LP A P F HHF T+ T C++ Sbjct: 12 SAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVV 44
>IF4B_YEAST (P34167) Eukaryotic translation initiation factor 4B (eIF-4B)| Length = 436 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 199 YRPIDVNAMPWECVPVIVQYWMPDG 125 YR + +N +PW+ P VQ W+ DG Sbjct: 101 YRAV-INNIPWDITPEGVQAWVEDG 124
>VL1_HPV05 (P06917) Major capsid protein L1| Length = 516 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 59 YNSSSENGEEKKVLLLMANSHRAIRHPVLDNNGYALP 169 +N + NG++ +V + N HR R + D N +ALP Sbjct: 51 FNVYNINGDKLEVPKVSGNQHRVFRLKLPDPNRFALP 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,278,021 Number of Sequences: 219361 Number of extensions: 790103 Number of successful extensions: 2603 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2603 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)