| Clone Name | rbah59f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CARB_CAUCR (Q9A4D6) Carbamoyl-phosphate synthase large chain (EC... | 33 | 0.63 | 2 | EXG_KLULA (Q12628) Glucan 1,3-beta-glucosidase precursor (EC 3.2... | 30 | 4.1 |
|---|
>CARB_CAUCR (Q9A4D6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1099 Score = 32.7 bits (73), Expect = 0.63 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +3 Query: 156 VSIQFSMNDPHSNNMFMLHRVDSNPRLSVPTVNPRVQRKIP 278 +++QF++ +PHS+N PR+ V VNPR R +P Sbjct: 838 MNVQFAIEEPHSDN----------PRIYVLEVNPRASRTVP 868
>EXG_KLULA (Q12628) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 429 Score = 30.0 bits (66), Expect = 4.1 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 433 IILLVSTLIGICLLMNMPLTKDTLLYSNVKI 341 ++ L+S L+ +CL +PL+K Y N K+ Sbjct: 6 VVSLISLLVSVCLAQPLPLSKRYFEYENYKV 36 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,907,759 Number of Sequences: 219361 Number of extensions: 1419831 Number of successful extensions: 3508 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3506 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)