ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf5f18 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os03g60840:12003.t05321:unspliced-genomic Bowman-Birk type trypsin inhibitor, putative, expressed| Length = 1100 Score = 79.4 bits (167), Expect(2) = 3e-18 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +1 / +2 Query: 154 CCDKCGICTRSFPPQCRCMDVSPTGCIPACKKCAKSTV 267 CCD CG CT+S PPQC+CMD P GC PACK C KS++ Sbjct: 440 CCDNCGGCTKSIPPQCQCMDARPAGCHPACKSCVKSSL 553 Score = 31.8 bits (63), Expect(2) = 3e-18 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 / +2 Query: 283 FQCKDLITNFCNTRCTKAA 339 +QC D I N C RCT AA Sbjct: 572 YQCMDRIPNLCQRRCTAAA 628 Score = 59.3 bits (123), Expect(2) = 5e-12 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = -2 / -3 Query: 263 VDLAHFLHAGMQPVGETSMHLHCGGKDLVQMPHLSQH 153 +DL LHAG P G SMH HCGG DLV P LSQH Sbjct: 549 LDLTQLLHAGWHPAGLASMHWHCGGIDLVHPPQLSQH 439 Score = 30.9 bits (61), Expect(2) = 5e-12 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 / -1 Query: 328 CSGCCRSW**DPCTGSCRGRR 266 CSG R W PCTG GRR Sbjct: 617 CSGAGRGWGCGPCTGRPAGRR 555 Score = 57.0 bits (118), Expect = 1e-07 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +3 / +1 Query: 150 AVLRQVRHLHQVFPAAVQMHGRLSDRLHPGMQEVRQVHRRR 272 AVLRQ+R +HQV PAAV +HGR + + PG+QE+RQV +R Sbjct: 436 AVLRQLRRVHQVDPAAVPVHGREAGGVPPGVQELRQVQPQR 558 Score = 35.4 bits (71), Expect(2) = 8e-05 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -3 / -1 Query: 262 WTWRTSCMPGCNRSERRPCICTAAG 188 WT R+SC PG RPC TAAG Sbjct: 548 WT*RSSCTPGGTPPASRPCTGTAAG 474 Score = 29.9 bits (59), Expect(2) = 8e-05 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 / -3 Query: 338 AALVQRVLQKLVMRSLHW 285 AA VQR Q+L MRS+HW Sbjct: 627 AAAVQRRWQRLGMRSMHW 574
>LOC_Os01g03390:12001.t00231:unspliced-genomic Bowman-Birk type bran trypsin inhibitor precursor, putative,| expressed Length = 996 Score = 30.9 bits (61), Expect(2) = 0.067 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 / +1 Query: 175 CTRSFPPQCRCMD 213 CTRS PP CRC D Sbjct: 478 CTRSIPPICRCND 516 Score = 24.4 bits (47), Expect(2) = 0.067 Identities = 9/33 (27%), Positives = 13/33 (39%) Frame = +1 / +1 Query: 229 CIPACKKCAKSTVGGRDSFQCKDLITNFCNTRC 327 C ACK C + + C+D T +C Sbjct: 529 CAAACKDCKRVKSSKPPRYVCQDQFTGQPGPKC 627
>LOC_Os01g65860:12001.t05947:unspliced-genomic clathrin assembly protein, putative, expressed| Length = 1831 Score = 30.9 bits (61), Expect(2) = 0.086 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 / +1 Query: 268 RRWTWRTSCMPGCNRSERRPC 206 RRW W T+C P R R C Sbjct: 445 RRWRWCTACSPTATRRTSRRC 507 Score = 24.0 bits (46), Expect(2) = 0.086 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +1 Query: 295 PCTGSCRGRRRWTWRT 248 PC G GR R WR+ Sbjct: 397 PCRGGSGGRGRGPWRS 444
>LOC_Os03g62480:12003.t05473:unspliced-genomic anthocyanidin 5,3-O-glucosyltransferase, putative, expressed| Length = 1787 Score = 36.8 bits (74), Expect = 0.13 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 / +2 Query: 289 TGSCRGRRRWTWRTSCMPGCNRS 221 T +CR RW WR+S P C RS Sbjct: 446 TPTCRRSGRWAWRSSASPACRRS 514
>LOC_Os01g09220:12001.t00800:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 1829 Score = 36.8 bits (74), Expect = 0.13 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -3 / -2 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSERR 212 PC G C RRRWTW G RS RR Sbjct: 901 PCGGGCSRRRRWTWAR*WGCGWCRSRRR 818
>LOC_Os01g03340:12001.t00226:unspliced-genomic Bowman-Birk type bran trypsin inhibitor precursor, putative,| expressed Length = 1220 Score = 28.6 bits (56), Expect(2) = 0.16 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 / +3 Query: 157 CDKCGICTRSFPPQCRCMD 213 C C + PP CRCMD Sbjct: 657 CCDKAFCNKMNPPTCRCMD 713 Score = 25.4 bits (49), Expect(2) = 0.16 Identities = 11/37 (29%), Positives = 13/37 (35%) Frame = +1 / +3 Query: 229 CIPACKKCAKSTVGGRDSFQCKDLITNFCNTRCTKAA 339 C ACK C + + CKD T C A Sbjct: 726 CAAACKDCQRVESSEPPRYVCKDRFTGQPGPMCKPRA 836
>LOC_Os01g03360:12001.t00228:unspliced-genomic Bowman-Birk type bran trypsin inhibitor precursor, putative,| expressed Length = 1149 Score = 28.6 bits (56), Expect(2) = 0.16 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 / +3 Query: 157 CDKCGICTRSFPPQCRCMD 213 C C + PP CRCMD Sbjct: 633 CCDKAFCNKMNPPTCRCMD 689 Score = 25.4 bits (49), Expect(2) = 0.16 Identities = 11/37 (29%), Positives = 13/37 (35%) Frame = +1 / +3 Query: 229 CIPACKKCAKSTVGGRDSFQCKDLITNFCNTRCTKAA 339 C ACK C + + CKD T C A Sbjct: 702 CADACKDCQRVESSEPPRYVCKDRFTGHPGPVCKPRA 812
>LOC_Os03g47730:12003.t04133:unspliced-genomic knotted1-interacting protein, putative, expressed| Length = 3006 Score = 36.3 bits (73), Expect = 0.17 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -3 / +1 Query: 286 GSCRGRRRWTWRTSCMPGCNRSERRPCICTAA 191 G CR R W + PG RS RRPC T+A Sbjct: 1177 GGCRRRSSRRWAPAPRPGTRRSWRRPCRTTSA 1272
>LOC_Os02g12840:12002.t01081:unspliced-genomic helicase conserved C-terminal domain containing protein, expressed| Length = 9369 Score = 36.3 bits (73), Expect = 0.17 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 / -1 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSERRPCICTA 194 PC GS W SC P CNR++ CI A Sbjct: 4797 PCLGSTSIHH*WYMSKSCAPACNRAQAFKCILDA 4696
>LOC_Os03g28310:12003.t02501:unspliced-genomic dnaJ domain containing protein, expressed| Length = 3480 Score = 29.9 bits (59), Expect(2) = 0.19 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -2 / -1 Query: 557 NPYCIPFRAYMKILRKKICCLFQTQEGTTSKNH 459 +PYC PFR K ++K +Q T K H Sbjct: 813 HPYCTPFRRIPKSYQEKQALTADSQNSPTPKYH 715 Score = 27.6 bits (54), Expect(2) = 0.19 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -3 / -2 Query: 271 RRRWTWRTSCMPGCNRSER 215 RR WR C PGC S R Sbjct: 170 RRGRRWRRMCPPGCGGSSR 114
>LOC_Os07g14340:12007.t01298:unspliced-genomic lustrin A, putative, expressed| Length = 1549 Score = 35.9 bits (72), Expect = 0.24 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 / -1 Query: 289 TGSCRGRRRWTWRTSCMPGCNRSERRPC 206 T +GRRRW R C GC R RR C Sbjct: 946 TVQMQGRRRWGRRRGCRRGCRRGCRRGC 863
>LOC_Os03g19104:12003.t01677:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7459 Score = 35.9 bits (72), Expect = 0.24 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 / -3 Query: 274 GRRRWTWRTSCMPGCNRSERRPCICTAAG 188 GRRR WR GC R +R P +C+ G Sbjct: 863 GRRRRLWRWGVGGGCRR*QRSPAVCSRGG 777
>LOC_Os05g47480:12005.t04184:unspliced-genomic transcription initiation factor IIB, putative, expressed| Length = 1493 Score = 35.4 bits (71), Expect = 0.33 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 / -3 Query: 280 CRGRRRWTWRTSCMPGCNRSERRPC 206 C RRRW WR C R RPC Sbjct: 999 CPRRRRWPWRRRARTCCRRRAARPC 925
>LOC_Os01g19420:12001.t01732:unspliced-genomic expressed protein| Length = 899 Score = 35.4 bits (71), Expect = 0.33 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 / +3 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSERR 212 P +C RRRWTWRTS S R Sbjct: 429 PTATACGARRRWTWRTSATAASGASPAR 512
>LOC_Os10g02700:12010.t00160:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2178 Score = 35.0 bits (70), Expect = 0.45 Identities = 19/60 (31%), Positives = 24/60 (40%) Frame = -3 / -3 Query: 316 CRSW**DPCTGSCRGRRRWTWRTSCMPGCNRSERRPCICTAAGKXXXXXXXXXXTASCLG 137 CRS * G+CR RRR +WR SC RS+ G+ +C G Sbjct: 349 CRSTR*RQRRGACRRRRRCSWRWSCAAN*PRSDPHGATRQCGGRERAAPEHGPQGRTCRG 170
>LOC_Os01g57040:12001.t05113:unspliced-genomic expressed protein| Length = 472 Score = 35.0 bits (70), Expect = 0.45 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 / -2 Query: 271 RRRWTWRTSCMPGCNRSERRPC 206 RRRW WR + PG RRPC Sbjct: 225 RRRWRWRPTWAPGRAHRPRRPC 160
>LOC_Os06g10310:12006.t00909:unspliced-genomic growth-regulating factor 1, putative| Length = 1293 Score = 26.7 bits (52), Expect(2) = 0.53 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 / -2 Query: 271 RRRWTWRTSCMPGCNRSERRPCICT 197 RRRW WR S RR C T Sbjct: 821 RRRWGWRWRAACRPTASSRRRCAAT 747 Score = 25.4 bits (49), Expect(2) = 0.53 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 / -2 Query: 292 CTGSCRGRRRWTWR 251 C GS R RRRW R Sbjct: 872 CCGSARRRRRWRGR 831
>LOC_Os10g39530:12010.t03196:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4349 Score = 34.5 bits (69), Expect = 0.62 Identities = 19/60 (31%), Positives = 24/60 (40%) Frame = -3 / -2 Query: 316 CRSW**DPCTGSCRGRRRWTWRTSCMPGCNRSERRPCICTAAGKXXXXXXXXXXTASCLG 137 CRS * G+CR RRR +WR SC RS+ G+ +C G Sbjct: 349 CRSTR*RQRRGACRRRRRRSWRWSCAAN*PRSDPHGATRQCGGRERAAPEHGPQGRTCRG 170
>LOC_Os08g36340:12008.t03374:unspliced-genomic potassium transporter 4, putative, expressed| Length = 10963 Score = 34.5 bits (69), Expect = 0.62 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 / +2 Query: 286 GSCRGRRRWTWRTSCMPGCNRSERR 212 G CR R RW WR SC G R Sbjct: 2420 GGCRSRCRWRWRRSCSGGTTAGSGR 2494
>LOC_Os06g22870:12006.t02100:unspliced-genomic OsIAA21 - Auxin-responsive Aux/IAA gene family member, expressed| Length = 3850 Score = 34.5 bits (69), Expect = 0.62 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 / +2 Query: 289 TGSCRGRRRWTWRTSCMPGCNRSERR 212 T CR RRR W+ SC GC RR Sbjct: 200 TSGCRRRRRRRWQRSCALGCRGLRRR 277
>LOC_Os05g28340:12005.t02483:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2770 Score = 34.5 bits (69), Expect = 0.62 Identities = 19/60 (31%), Positives = 24/60 (40%) Frame = -3 / -1 Query: 316 CRSW**DPCTGSCRGRRRWTWRTSCMPGCNRSERRPCICTAAGKXXXXXXXXXXTASCLG 137 CRS * G+CR RRR +WR SC RS+ G+ +C G Sbjct: 349 CRSTR*RQRRGACRRRRRRSWRWSCAAN*PRSDPHGATRQCGGRERAAPEHGPQGRTCRG 170
>LOC_Os02g51600:12002.t04742:unspliced-genomic type I inositol-1,4,5-trisphosphate 5-phosphatase CVP2, putative,| expressed Length = 3032 Score = 34.5 bits (69), Expect = 0.62 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 / -2 Query: 286 GSCRGRRRWTWRTSCMPGCNRSERR 212 G CR RRW+ SC CN + RR Sbjct: 1903 GGCRRSRRWSGAASCSSRCNPASRR 1829
>LOC_Os02g06140:12002.t00512:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5026 Score = 34.5 bits (69), Expect = 0.62 Identities = 19/60 (31%), Positives = 24/60 (40%) Frame = -3 / -1 Query: 316 CRSW**DPCTGSCRGRRRWTWRTSCMPGCNRSERRPCICTAAGKXXXXXXXXXXTASCLG 137 CRS * G+CR RRR +WR SC RS+ G+ +C G Sbjct: 349 CRSTR*RQRRGACRRRRRRSWRWSCAAN*PRSDPHGATRQCGGRERAAPEHGPQGRTCRG 170
>LOC_Os01g67800:12001.t06137:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4335 Score = 34.5 bits (69), Expect = 0.62 Identities = 19/60 (31%), Positives = 24/60 (40%) Frame = -3 / -3 Query: 316 CRSW**DPCTGSCRGRRRWTWRTSCMPGCNRSERRPCICTAAGKXXXXXXXXXXTASCLG 137 CRS * G+CR RRR +WR SC RS+ G+ +C G Sbjct: 349 CRSTR*RQRRGACRRRRRRSWRWSCAAN*PRSDPHGATRQCGGRERAAPEHGPQGRTCRG 170
>LOC_Os05g10650:12005.t00899:unspliced-genomic 6-phosphofructokinase 2, putative, expressed| Length = 2281 Score = 34.1 bits (68), Expect = 0.85 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 / +2 Query: 292 CTGSCRGRRRWTWRTSCMPGCN 227 C GS R R RW+ RT C GC+ Sbjct: 1772 CRGSRRSRTRWSSRTGCGRGCS 1837
>LOC_Os04g56240:12004.t05096:unspliced-genomic triacylglycerol lipase, putative, expressed| Length = 3672 Score = 34.1 bits (68), Expect = 0.85 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 / +2 Query: 292 CTGSCRGRRRWTWRTSCMPGCNRSERRPC 206 C + R RRRWT +C P +R PC Sbjct: 1337 CWRTTRRRRRWTGSPACTPSGSRGSATPC 1423
>LOC_Os01g42294:12001.t03748:unspliced-genomic atypical receptor-like kinase MARK, putative, expressed| Length = 5955 Score = 34.1 bits (68), Expect = 0.85 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 / +1 Query: 277 RGRRRWTWRTSCMPGCNRSERRPC 206 +G RWT C P C RS RR C Sbjct: 5209 KGTARWTSHGGCSPWCGRSGRRRC 5280
>LOC_Os07g41160:12007.t03771:unspliced-genomic RNA-binding protein, putative, expressed| Length = 3986 Score = 26.3 bits (51), Expect(2) = 0.89 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 / -1 Query: 274 GRRRWTWRTSCMPGCNRSERR 212 G WT ++C P C+ S RR Sbjct: 2246 GHPPWTTPSACPPSCSSSGRR 2184 Score = 24.9 bits (48), Expect(2) = 0.89 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -3 / -1 Query: 295 PCTGSCRGRR 266 P +GSCRGRR Sbjct: 2342 PASGSCRGRR 2313
>LOC_Os08g31200:12008.t02869:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative| Length = 2089 Score = 33.6 bits (67), Expect = 1.2 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +3 / -2 Query: 150 AVLRQVRHLHQVFPAAVQMHGRLSDRLHPGMQEVRQVHRRRPRQ 281 AV+ V V PA V+ HG+L R ++ VR H RPR+ Sbjct: 174 AVVELVVDEGDVEPARVEQHGQLQHRRDVALRRVRDHHGVRPRR 43
>LOC_Os04g27980:12004.t02499:unspliced-genomic acidic endochitinase precursor, putative, expressed| Length = 1622 Score = 33.6 bits (67), Expect = 1.2 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 / -1 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSER 215 P + + R RR WR SC PGC R+ R Sbjct: 1187 PTSSTPRRTRRRCWRGSCRPGCCRTGR 1107
>LOC_Os04g25490:12004.t02257:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative, expressed| Length = 2559 Score = 33.6 bits (67), Expect = 1.2 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +3 / -1 Query: 150 AVLRQVRHLHQVFPAAVQMHGRLSDRLHPGMQEVRQVHRRRPRQ 281 AV+ V V PA V+ HG+L R ++ VR H RPR+ Sbjct: 174 AVVELVVDEGDVEPARVEQHGQLQHRRDVALRRVRDHHGVRPRR 43
>LOC_Os03g50210:12003.t04363:unspliced-genomic expressed protein| Length = 1735 Score = 33.6 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -3 / +3 Query: 292 CTGSCRGRRRWTWRTSCMPGCNRSERR 212 C RGRRRW R +C G RS RR Sbjct: 123 CVREGRGRRRWGGRWTCCWGGRRSRRR 203
>LOC_Os02g38680:12002.t03506:unspliced-genomic conserved hypothetical protein| Length = 6338 Score = 33.6 bits (67), Expect = 1.2 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 / +1 Query: 413 FPVDSASLSG*MPRRNDSCSSFLLVS 490 FPVDSA+++G P N +CS F +S Sbjct: 181 FPVDSAAVAGEAPNPNPTCSLFPFIS 258
>LOC_Os07g01710:12007.t00069:unspliced-genomic phytosulfokine receptor precursor, putative, expressed| Length = 3654 Score = 33.6 bits (67), Expect = 1.2 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 / +1 Query: 163 KCGICTRSFPPQCRCMDVSPTGCIPACKKCAKST 264 +C C RS P RC SP PA ++C ST Sbjct: 658 RCRTCPRSTPATTRCPARSPPTSAPARRRCGCST 759
>LOC_Os02g36810:12002.t03318:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative| Length = 1605 Score = 29.9 bits (59), Expect(2) = 1.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 / -3 Query: 319 CCRSW**DPCTGSCRGRRRWTWR 251 CCR W P G RG RR WR Sbjct: 802 CCR*WRPRPPCGPSRGARR*AWR 734 Score = 23.5 bits (45), Expect(2) = 1.4 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -2 / -2 Query: 257 LAHFLHAGMQPVGETSMHLHCGGKDLV 177 LA F+ P MH CGG L+ Sbjct: 119 LASFIIGVTCPCAGNGMHTACGGGSLI 39
>LOC_Os08g34010:12008.t03141:unspliced-genomic ZF-HD protein dimerisation region containing protein, expressed| Length = 1558 Score = 33.1 bits (66), Expect = 1.6 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -3 / +2 Query: 280 CRGRRRWTWRTSC 242 CRG RRW WR SC Sbjct: 452 CRGPRRWRWRRSC 490
>LOC_Os06g49490:12006.t04633:unspliced-genomic expressed protein| Length = 801 Score = 33.1 bits (66), Expect = 1.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 / -1 Query: 280 CRGRRRWTWRTSCMPGCNRSERR 212 CRGRR W WR P R RR Sbjct: 447 CRGRRAWAWRRRRRPHRRRRRRR 379
>LOC_Os06g05320:12006.t00421:unspliced-genomic anthocyanin 5-aromatic acyltransferase, putative, expressed| Length = 1742 Score = 33.1 bits (66), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 / -3 Query: 271 RRRWTWRTSCMPGCNRSERRPCICTAAG 188 RRRW WR C S RRP AG Sbjct: 1197 RRRWPWRLLWRCSCRSSPRRPAGAAGAG 1114
>LOC_Os04g43060:12004.t03851:unspliced-genomic enzyme of the cupin superfamily, putative, expressed| Length = 1030 Score = 33.1 bits (66), Expect = 1.6 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +3 / +1 Query: 228 LHPGMQEVRQVHRRRPRQLP 287 L G +EVR+V RRRPR+LP Sbjct: 562 LREGHREVRRVRRRRPRRLP 621
>LOC_Os04g08240:12004.t00694:unspliced-genomic hypothetical protein| Length = 1527 Score = 33.1 bits (66), Expect = 1.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 / -3 Query: 253 RTSCMPGCNRSERRPCIC 200 R+ C P CN S+ RPC C Sbjct: 1273 RSPCRPPCNASDHRPCSC 1220
>LOC_Os01g37590:12001.t03301:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 2275 Score = 33.1 bits (66), Expect = 1.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 / +2 Query: 271 RRRWTWRTSCMPGCNR 224 RRRW W +SC GC R Sbjct: 383 RRRWCWGSSCASGCRR 430 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 / -1 Query: 289 TGSCRGRRRWTWRTSCMPGCNRSERR 212 TG CR RRRWT C R RR Sbjct: 784 TGRCRSRRRWT*GRRCRGR*GRGRRR 707
>LOC_Os08g19030:12008.t01724:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1404 Score = 26.3 bits (51), Expect(2) = 1.7 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 / -2 Query: 272 PPTVDLAHFLHAGMQPVGETSMHLHCGG 189 PP + ++H G PVG S C G Sbjct: 1058 PPAL*CGTWVHPGASPVGSQSASYICAG 975 Score = 24.0 bits (46), Expect(2) = 1.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 / -3 Query: 419 PESLKRNWKSTS 384 P L+RNW STS Sbjct: 1198 PSPLERNWSSTS 1163
>LOC_Os12g44050:12012.t04071:unspliced-genomic purple acid phosphatase precursor, putative, expressed| Length = 836 Score = 32.7 bits (65), Expect = 2.2 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 / +3 Query: 292 CTGSCRGRRRWTWRTSCMPGCNRSER 215 CTG R RRR W P C+RS R Sbjct: 150 CTGGRRRRRRTWWTCHWTPTCSRSRR 227
>LOC_Os12g06210:12012.t00507:unspliced-genomic harpin-induced protein, putative| Length = 675 Score = 32.7 bits (65), Expect = 2.2 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 / +3 Query: 159 RQVRHLHQVFPAAVQMHGRLSDRLHPGMQEVRQVHRRR 272 R+ RH + P A +H R DRL P + R+ RRR Sbjct: 324 RRQRHRPRGVPPAQDVHHRRGDRLRPERRRRRRCRRRR 437
>LOC_Os10g07200:12010.t00581:unspliced-genomic hsp20/alpha crystallin family protein, expressed| Length = 1982 Score = 32.7 bits (65), Expect = 2.2 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -3 / +3 Query: 292 CTGSCRGRRRWTWRTSCMPGCNRSERRPCICTAAG 188 C C RR TWR+ C+RS RP T G Sbjct: 1020 CGCRCPA*RRTTWRSPPPTNCSRSSVRPVAATRGG 1124
>LOC_Os09g09360:12009.t00728:unspliced-genomic expressed protein| Length = 13083 Score = 32.7 bits (65), Expect = 2.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 / -3 Query: 283 SCRGRRRWTWRTSCMPGCNRSER 215 +CR RR W WR C G RS R Sbjct: 439 TCRRRRSWGWRRGCRSGTCRS*R 371
>LOC_Os08g31670:12008.t02912:unspliced-genomic carbohydrate transporter/ sugar porter/ transporter, putative,| expressed Length = 2840 Score = 32.7 bits (65), Expect = 2.2 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 / +1 Query: 292 CTGSCRGRRRWTWRTSCMP 236 C GSC R W W ++C P Sbjct: 841 CVGSCSKRNEWYWASTCNP 897
>LOC_Os07g34040:12007.t03081:unspliced-genomic harpin-induced protein, putative, expressed| Length = 863 Score = 32.7 bits (65), Expect = 2.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 / +2 Query: 268 RRWTWRTSCMPGCNRSERRPCICT 197 RRWT R+S C RS R P CT Sbjct: 221 RRWT*RSSSSASCRRS*RPPSACT 292
>LOC_Os02g41530:12002.t03739:unspliced-genomic hypothetical protein| Length = 449 Score = 32.7 bits (65), Expect = 2.2 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 / +1 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNR 224 PC + GR W WR C GC R Sbjct: 265 PCMATMLGRLHWRWRRFCDGGCWR 336
>LOC_Os01g36080:12001.t03158:unspliced-genomic protein phosphatase 2C containing protein, expressed| Length = 7624 Score = 32.7 bits (65), Expect = 2.2 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 / -3 Query: 289 TGSCRGRRRWTWRTS 245 +G+CRGRRRWT R S Sbjct: 425 SGTCRGRRRWTARAS 381
>LOC_Os06g47530:12006.t04439:unspliced-genomic serine/threonine-protein kinase receptor precursor, putative,| expressed Length = 4927 Score = 32.7 bits (65), Expect = 2.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 / -1 Query: 148 TLCCDKCGICTRSFPPQCRCMDVSPTGCIPACK 246 T CC R+ PP+ + DVSP +PAC+ Sbjct: 100 TGCCSPWRCAPRATPPRPQLPDVSPLRPLPACR 2
>LOC_Os01g03380:12001.t00230:unspliced-genomic Bowman-Birk type bran trypsin inhibitor precursor, putative,| expressed Length = 788 Score = 32.7 bits (65), Expect = 2.2 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 / +1 Query: 157 CDKCGICTRSFPPQCRCMD 213 C IC+RS PP CRC D Sbjct: 394 CCDMDICSRSLPPICRCAD 450
>LOC_Os11g44390:12011.t03967:unspliced-genomic transposon protein, putative, unclassified| Length = 7245 Score = 25.8 bits (50), Expect(2) = 2.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 / +2 Query: 231 HPGMQEVRQVHRRRP 275 HPG +EV VHR P Sbjct: 4370 HPGPREVHPVHRTAP 4414 Score = 23.5 bits (45), Expect(2) = 2.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 / +3 Query: 184 SFPPQCRCMDVSPTGCI 234 S PP R + +PTGC+ Sbjct: 4200 SSPPPVRAVHGAPTGCM 4250
>LOC_Os02g49060:12002.t04490:unspliced-genomic AAP7, putative, expressed| Length = 6915 Score = 27.2 bits (53), Expect(2) = 2.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 / -1 Query: 237 RDATGRRDVHASALRRERP 181 RDA RR H ALRR RP Sbjct: 5211 RDARPRRRPHRLALRRRRP 5155 Score = 22.1 bits (42), Expect(2) = 2.8 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 / -3 Query: 277 RGRRRWTWRTS 245 RGRRRW+ R S Sbjct: 5233 RGRRRWSPRCS 5201
>LOC_Os05g34450:12005.t03039:unspliced-genomic ASYMMETRIC LEAVES2, putative, expressed| Length = 3678 Score = 26.7 bits (52), Expect(2) = 2.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 / +3 Query: 277 RGRRRWTWRTSCMPGCNRSERRPCICTAA 191 R RRR W TS C+R+ RR AA Sbjct: 594 RRRRRRWWITSSGARCSRTARRTSSAAAA 680 Score = 22.6 bits (43), Expect(2) = 2.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -3 / +3 Query: 325 SGCCRSW**DPCTGSCRGRRRW 260 S C R W TG R RRRW Sbjct: 549 SVCRRRWRCRRRTGRRRRRRRW 614
>LOC_Os04g51110:12004.t04588:unspliced-genomic cell division cycle protein 20, putative, expressed| Length = 2877 Score = 25.8 bits (50), Expect(2) = 3.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 / +2 Query: 271 RRRWTWRTSCMPGCNRSER 215 R WTWRT+C R+ R Sbjct: 815 RWTWTWRTTC*RSRGRTRR 871 Score = 23.5 bits (45), Expect(2) = 3.0 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 / +2 Query: 289 TGSCRGRRRWTW 254 TG R RRWTW Sbjct: 791 TGLFRTGRRWTW 826
>LOC_Os05g38710:12005.t03413:unspliced-genomic lipin, N-terminal conserved region family protein, expressed| Length = 7392 Score = 29.0 bits (57), Expect(2) = 3.0 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 / +1 Query: 579 FFFFFGSESILHSIPCI 529 FFFFFG +++H + C+ Sbjct: 4129 FFFFFGGRALIHLLFCV 4179 Score = 25.4 bits (49), Expect(2) = 3.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 / +2 Query: 519 FAEKNMLFISDTRRNDEQESFLL 451 F KN++FI RR + SFL+ Sbjct: 5885 FCIKNLIFIFIFRRKERHRSFLI 5953
>LOC_Os12g28770:12012.t02587:unspliced-genomic expressed protein| Length = 2563 Score = 32.2 bits (64), Expect = 3.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 / -1 Query: 277 RGRRRWTWRTSCMPGCNRSERRPC 206 R RRRW R+ PGC RR C Sbjct: 1501 RRRRRWRTRSRRSPGCRAGTRRRC 1430
>LOC_Os09g25740:12009.t02253:unspliced-genomic expressed protein| Length = 2218 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 / -3 Query: 322 GCCRSW**DPCTGSCRGRRRWTWR 251 G C SW DP GS R RRRW R Sbjct: 335 GGCASWRWDPPCGSDRQRRRWLRR 264
>LOC_Os07g44910:12007.t04131:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1866 Score = 32.2 bits (64), Expect = 3.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 / +2 Query: 316 CRSW**DPCTGSCRGRRRWTWRTSCMPGC 230 CR W GS RRRW T+C GC Sbjct: 395 CR*WCTTTAAGSRCSRRRWRRSTACAAGC 481
>LOC_Os03g25710:12003.t02268:unspliced-genomic hypothetical protein| Length = 2763 Score = 32.2 bits (64), Expect = 3.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 / -2 Query: 274 GRRRWTWRTSCMPGCNRSERRPC 206 GRRRW TS GC RS R C Sbjct: 1835 GRRRWRPATSLAGGCTRSPGRGC 1767
>LOC_Os03g16130:12003.t01399:unspliced-genomic ATP binding protein, putative, expressed| Length = 5777 Score = 32.2 bits (64), Expect = 3.0 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 / -1 Query: 298 DPCTGSCRGRRRWTWRTSCMPGCNRSERRPCICTAAG 188 D C G CR RR + C RS RP C A G Sbjct: 398 DGCAGGCRPRRGGSRGACC*AAPRRSPSRPPPCPACG 288
>LOC_Os02g36020:12002.t03239:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 10095 Score = 32.2 bits (64), Expect = 3.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 / +2 Query: 292 CTGSCRGRRRWTWRTSCMPGCNRSERRPC 206 C +C RRRWTWR G R R C Sbjct: 5693 CCCTCTRRRRWTWRRRRYGGPWRPPRGSC 5779
>LOC_Os01g08470:12001.t00725:unspliced-genomic protein binding protein, putative, expressed| Length = 2275 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 / +2 Query: 283 SCRGRRRWTWRTSCMPGCNRSERRPCICTAAG 188 SCR R RT+ P R R PC TA G Sbjct: 1049 SCRASRTSPSRTTSSPASRRPARTPCRATATG 1144
>LOC_Os02g32814:12002.t02923:unspliced-genomic heavy metal-associated domain containing protein, expressed| Length = 14038 Score = 32.2 bits (64), Expect = 3.1 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 / +2 Query: 154 CCDKCGICTRSFPPQCRCMDVSPTGCIPACKKCAKSTV 267 CC C C+RS Q C+ ++ CI K +K + Sbjct: 13742 CCSSCSCCSRSSSGQG*CLMITHNACIDIWKLNSKRLI 13855
>LOC_Os01g04050:12001.t00294:unspliced-genomic Bowman-Birk type wound-induced proteinase inhibitor WIP1 precursor,| putative, expressed Length = 996 Score = 32.2 bits (64), Expect = 3.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 / +1 Query: 229 CIPACKKCAKSTVGGRDSFQCKDLITNFCNTRC 327 C P CKKCA F+C D C C Sbjct: 541 CDPVCKKCAVVKTYPVKMFKCTDTFLGMCGPPC 639
>LOC_Os01g03680:12001.t00259:unspliced-genomic Bowman-Birk type bran trypsin inhibitor precursor, putative,| expressed Length = 996 Score = 32.2 bits (64), Expect = 3.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 / +3 Query: 157 CDKCGICTRSFPPQCRCMD 213 C +CTRS PP C C D Sbjct: 399 CCDDAVCTRSMPPTCSCQD 455
>LOC_Os01g53650:12001.t04784:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 982 Score = 24.9 bits (48), Expect(2) = 3.2 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +1 / +2 Query: 247 KCAKSTVGGRDSFQCKDLITNFCNTRCTKAA*LYWTSC 360 + + T GGR ++ ++ F RC ++ WTSC Sbjct: 140 EASSPTWGGRCAYDEDFMMYEFKVRRCPRSRAHEWTSC 253 Score = 24.4 bits (47), Expect(2) = 3.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 / +3 Query: 181 RSFPPQCRCMDVSP 222 RSF P+CRC +P Sbjct: 99 RSF*PRCRCTSPAP 140
>LOC_Os09g36400:12009.t03116:unspliced-genomic hypothetical protein| Length = 4351 Score = 25.4 bits (49), Expect(2) = 3.9 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 / +2 Query: 292 CTGSCRGRRRWTWRTSC 242 CTG+CR R W C Sbjct: 332 CTGACRSRSIWNM*KRC 382 Score = 23.5 bits (45), Expect(2) = 3.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 / +2 Query: 361 DKRSNIITRP*CSGCCRS 308 D RS T P C+G CRS Sbjct: 299 DARSITRT*PWCTGACRS 352
>LOC_Os09g38870:12009.t03354:unspliced-genomic conserved hypothetical protein| Length = 2921 Score = 24.4 bits (47), Expect(2) = 4.0 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 / +1 Query: 286 GSCRGRRRWTWR 251 G RGR RW WR Sbjct: 1090 GRGRGRGRWRWR 1125 Score = 24.4 bits (47), Expect(2) = 4.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 / +1 Query: 225 GRRDVHASALRRERPG 178 GRR H RR+RPG Sbjct: 1156 GRRGSHPHPCRRQRPG 1203
>LOC_Os06g20120:12006.t01829:unspliced-genomic CND41, chloroplast nucleoid DNA binding protein, putative| Length = 2122 Score = 25.4 bits (49), Expect(2) = 4.1 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 / +3 Query: 268 RRWTWRTSCMPGCNRSER 215 RRW W T+C G + S R Sbjct: 2058 RRWRWCTTCREGRSGSFR 2111 Score = 23.5 bits (45), Expect(2) = 4.1 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -3 / +3 Query: 313 RSW**DPCTGSCRGRRRWTW 254 R+W C + RRRW W Sbjct: 1977 RAWRSRRCRPTATRRRRWRW 2036
>LOC_Os12g23180:12012.t04109:unspliced-genomic RNA binding protein, putative, expressed| Length = 2669 Score = 31.8 bits (63), Expect = 4.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 / -2 Query: 328 CSGCCRSW**DPCTGSCRGRRR 263 C G CR W* P + +CRGR R Sbjct: 2377 CRGSCRRW*SRPPS*TCRGRSR 2312
>LOC_Os11g27370:12011.t02351:unspliced-genomic anthocyanidin 3-O-glucosyltransferase, putative, expressed| Length = 1586 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 / +2 Query: 283 SCRGRRRWTWRTSCMPGCNRSERRPCICTA 194 SCR R W C P R R CIC A Sbjct: 137 SCRRRPTWPASRPCCPRTARPSSRRCICRA 226
>LOC_Os08g16910:12008.t01562:unspliced-genomic mannitol dehydrogenase, putative, expressed| Length = 2972 Score = 31.8 bits (63), Expect = 4.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 / -1 Query: 319 CCRSW**DPCTGSCRGRRRWTWRTSCMPGCNRSERRPC 206 C RS PCT RR TW SC P R R C Sbjct: 2102 CRRSGTSSPCTRRPPCRRP*TWSRSCRPPSPRRRSRAC 1989
>LOC_Os07g32620:12007.t02944:unspliced-genomic anthocyanidin 5,3-O-glucosyltransferase, putative, expressed| Length = 1665 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -3 / +2 Query: 271 RRRWTWRTSCMPGCNRSERRPCICTAA 191 RRR + RTS G RS RRPC +A+ Sbjct: 803 RRRRSSRTSACGGSTRSPRRPCSSSAS 883
>LOC_Os07g12480:12007.t01119:unspliced-genomic protein kinase domain containing protein| Length = 1983 Score = 31.8 bits (63), Expect = 4.2 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -3 / -3 Query: 316 CRSW**DPCTGSCRGRRRWTWRTSCMPGCNRSERRP 209 CR * G+CR RRR T R + G R RP Sbjct: 697 CRGC*RSRAPGACRARRRGTARAAAARGTRRRRWRP 590
>LOC_Os06g05310:12006.t00420:unspliced-genomic transferase family protein, expressed| Length = 2655 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 / -3 Query: 274 GRRRWTWRTSCMPGCNRSERRPCICTAAG 188 GRRRW WR C S RP AG Sbjct: 2287 GRRRWPWRRMW*RSCRSSPCRPAGAAGAG 2201
>LOC_Os06g05300:12006.t00419:unspliced-genomic transferase family protein, expressed| Length = 1928 Score = 31.8 bits (63), Expect = 4.2 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +3 / +3 Query: 153 VLRQVRHLHQVFPAAVQMHGRLSDRLHPGMQEVRQVHRRRPRQLP 287 +LR+ LH PA++ + GR + + + + RRRPR+LP Sbjct: 114 LLRRHVRLHDADPASLLLRGRRAPAVPVARRLPPVIPRRRPRRLP 248
>LOC_Os04g40780:12004.t03639:unspliced-genomic F-box domain containing protein| Length = 1807 Score = 31.8 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -3 / -1 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSERRPCICTAA 191 P + SC RRR WR S R RRP C A Sbjct: 220 PPSRSCSSRRRIAWR*SRRRRARRRSRRPA*CWGA 116
>LOC_Os03g55100:12003.t04775:unspliced-genomic cyclic nucleotide-gated ion channel 2, putative, expressed| Length = 5903 Score = 31.8 bits (63), Expect = 4.2 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +3 / +3 Query: 165 VRHLHQVFPAAVQMHGRLSDRLHPGMQEVRQVHRRRPRQLPV 290 +R LH+ AAV++HGR R G R+ RPR PV Sbjct: 549 LRALHRPRRAAVRVHGRRPRRRRHGAPHRRRPGAPRPRPPPV 674
>LOC_Os03g53780:12003.t04696:unspliced-genomic ammonium transporter 2, putative| Length = 1495 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -3 / +1 Query: 283 SCRGRRRWTWRTSCMPGCNRSERRPCICTAAGK 185 S RGRRR R+ C+RS R C C G+ Sbjct: 673 SVRGRRRTGRRSRRTTSCSRSPERGCCCGWGGR 771
>LOC_Os03g51150:12003.t04444:unspliced-genomic expressed protein| Length = 2320 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 / -1 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSERRP 209 P TGS RGR + +C P C R+ RP Sbjct: 1687 PGTGSWRGRSGRSTPPACSPRCTRARTRP 1601
>LOC_Os03g25869:12003.t02280:unspliced-genomic expressed protein| Length = 7899 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 / +2 Query: 289 TGSCRGRRRWTWRTSCMPGCNRSERR 212 +G RGR RW W +S C RS RR Sbjct: 854 SGRSRGRSRWRWCSSPSATCCRSWRR 931
>LOC_Os03g25840:12003.t02278:unspliced-genomic cationic amino acid transporter, putative, expressed| Length = 993 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 / +2 Query: 289 TGSCRGRRRWTWRTSCMPGCNRSERR 212 +G RGR RW W +S C RS RR Sbjct: 815 SGRSRGRSRWRWCSSPSATCCRSWRR 892
>LOC_Os03g16334:12003.t01418:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 4996 Score = 31.8 bits (63), Expect = 4.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 / -1 Query: 277 RGRRRWTWRTSCMPGCNRSERR 212 RG RRW WR PG R RR Sbjct: 964 RGNRRWPWRARRRPGS*RRTRR 899
>LOC_Os03g11010:12003.t00902:unspliced-genomic metal transporter Nramp3, putative, expressed| Length = 4123 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 / +3 Query: 292 CTGSCRGRRRWTWRTSCMPGCNRSERRPCICTAAGK 185 C G C GRR W SC P + S R ++AG+ Sbjct: 411 CCGCCCGRRSWAPWCSCSPRGSGSPRGSTSPSSAGR 518
>LOC_Os02g16680:12002.t01461:unspliced-genomic BZO2H2, putative, expressed| Length = 3081 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -3 / -2 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSERR 212 P + S RGRRR TWRT+ G R+ R Sbjct: 353 PRSRSWRGRRRRTWRTAAGAGRRRASGR 270
>LOC_Os01g71720:12001.t06465:unspliced-genomic GABA-specific permease, putative, expressed| Length = 4456 Score = 31.8 bits (63), Expect = 4.2 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 / +2 Query: 316 CRSW**DPCTGSCRGRRRWTWRTS 245 C W PC+ CR R RW R S Sbjct: 4007 CSGWPPSPCSSRCRWRTRWRRRRS 4078
>LOC_Os01g41410:12001.t03661:unspliced-genomic hypothetical protein| Length = 315 Score = 31.8 bits (63), Expect = 4.2 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 / -3 Query: 277 RGRRRWTWRTSCMPGCNRS 221 RGRRR WR+SC+P RS Sbjct: 130 RGRRRSKWRSSCVPVTARS 74
>LOC_Os01g35100:12001.t03065:unspliced-genomic zinc finger, C3HC4 type family protein| Length = 786 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 / +2 Query: 307 W**DPCTGSCRGRRRWTWRTSCMPGCNRS 221 W T S RRR WR C PGC S Sbjct: 212 WTAPAATSSSTTRRRGGWRGPCSPGCGSS 298
>LOC_Os01g22860:12001.t02016:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 603 Score = 31.8 bits (63), Expect = 4.2 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 / +1 Query: 144 HDAVLRQVRHLHQVFPAAVQMHGRLSDRLHPGMQEVRQVHRRRPRQLP 287 HD+ + R +V P+ G L LH G++ R RR P+ LP Sbjct: 187 HDSEVEIKRRPRRVLPSQTLPSGALQSGLHDGLRPWRGGGRRPPQCLP 330
>LOC_Os07g04530:12007.t00341:unspliced-genomic GYF domain containing protein, expressed| Length = 9254 Score = 31.8 bits (63), Expect = 4.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 / -2 Query: 154 CCDKCGICTRSFPPQCRCMDVSPTGCIPACKKC 252 CC C C R F C C + CI C C Sbjct: 5305 CCSSCSSCNRCFCCCCICCCICCCCCICCCICC 5207
>LOC_Os03g22530:12003.t02003:unspliced-genomic lichenase-2 precursor, putative| Length = 447 Score = 26.3 bits (51), Expect(2) = 4.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -3 / -3 Query: 271 RRRWTWRTSCMPGCNRSERRP 209 RRR S PGC+R RRP Sbjct: 346 RRRTGITPSGRPGCSRGSRRP 284 Score = 23.5 bits (45), Expect(2) = 4.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 / -3 Query: 182 LVQMPHLSQHSVVPW 138 L Q+P L +HS PW Sbjct: 64 LSQIPSLLRHSSAPW 20
>LOC_Os03g12360:12003.t01035:unspliced-genomic trehalose-6-phosphate synthase, putative, expressed| Length = 4437 Score = 26.7 bits (52), Expect(3) = 4.9 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = -3 / +2 Query: 256 WRTSCMPGCNRSERRPCICTAAG 188 WR C C R P C A+G Sbjct: 3788 WRGGCWRACRRGACAPTSCCASG 3856 Score = 22.6 bits (43), Expect(3) = 4.9 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = -3 / +2 Query: 292 CTGSCRGRRRWTWRTSCMPGC 230 C+ + R WRT+ P C Sbjct: 2294 CSSTSRSSSTSAWRTTSSPRC 2356 Score = 22.1 bits (42), Expect(3) = 4.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 / +2 Query: 487 HKKERRARIISSRHL 443 HKKER+ +I+ S L Sbjct: 203 HKKERKRKILQSPSL 247
>LOC_Os11g17720:12011.t01549:unspliced-genomic expressed protein| Length = 1609 Score = 24.9 bits (48), Expect(2) = 5.6 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 / +2 Query: 283 SCRGRRRWTWR 251 SC +RWTWR Sbjct: 593 SCPSSQRWTWR 625 Score = 23.5 bits (45), Expect(2) = 5.6 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 / +1 Query: 257 LAHFLHAGMQPVGETSMHLHCGGKDLVQ 174 L + G P+G T +HL G L Q Sbjct: 727 LLRYYQCGSIPIGRTDLHLPEGVTSLPQ 810
>LOC_Os08g41440:12008.t03873:unspliced-genomic NAD-dependent epimerase/dehydratase family protein, putative,| expressed Length = 2014 Score = 27.2 bits (53), Expect(2) = 5.6 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 / -2 Query: 277 RGRRRWTWRTS 245 RGRRRWT RTS Sbjct: 753 RGRRRWTRRTS 721 Score = 24.4 bits (47), Expect(2) = 5.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 / -2 Query: 316 CRSW**DPCTGSCRGRRR 263 C +W* C+ SCRG R Sbjct: 1314 CWAW*RRACSPSCRGASR 1261
>LOC_Os11g36470:12011.t03194:unspliced-genomic cysteine-type endopeptidase/ double-stranded DNA binding protein,| putative, expressed Length = 19413 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 / -3 Query: 368 LIMPISLCFSSFFSGFPVDSASLSG*MPRRNDSC 469 L+ P LCF SFF FP +S + P + C Sbjct: 10102 LVCPSLLCFISFFLFFPFSFSSCTATFPHHSHIC 10001
>LOC_Os11g12740:12011.t01161:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 5313 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -3 / +2 Query: 340 TRP*CSGCCRSW**DPCTGSCRGRRRWTWRTSC 242 TRP + SW C CR R WTW + C Sbjct: 1571 TRPTSASAWGSWWR*RCWCGCRRGRGWTWGSGC 1669
>LOC_Os11g05810:12011.t00472:unspliced-genomic expressed protein| Length = 1136 Score = 31.3 bits (62), Expect = 5.7 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 / -3 Query: 271 RRRWTWRTSCMPGCNRSERRPC 206 RRRW WR GC+R C Sbjct: 342 RRRWRWRRGLHHGCHRRRNHGC 277
>LOC_Os10g36360:12010.t02918:unspliced-genomic expressed protein| Length = 682 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = -3 / +2 Query: 322 GCCRSW**DPCTGSCRGRRRWTWRTSCMPGCNRSERR 212 GC R + PC + RW WR C P RR Sbjct: 32 GCWRRFLAPPCCMAPAAWPRWRWRGRCWPAAAAPSRR 142
>LOC_Os09g16270:12009.t01414:unspliced-genomic hypothetical protein| Length = 609 Score = 31.3 bits (62), Expect = 5.7 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 / -3 Query: 277 RGRRRWTWRTSCMP 236 RG + WTWR SCMP Sbjct: 109 RG*QGWTWRRSCMP 68
>LOC_Os06g34830:12006.t03180:unspliced-genomic cationic amino acid transporter 4, putative, expressed| Length = 2491 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 / -1 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSERRP 209 P T S RG RWTW + P R+ P Sbjct: 1966 PATPSGRGWWRWTWPAATAPAARRTPAAP 1880
>LOC_Os05g44400:12005.t03929:unspliced-genomic GATA transcription factor 13, putative, expressed| Length = 2154 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 / +3 Query: 271 RRRWTWRTSCMPGCNRSERRPCICTAAG 188 R RW WR P + S RRP AAG Sbjct: 336 RDRWRWRRRTTPAGSVSRRRPEAAAAAG 419
>LOC_Os04g51830:12004.t04659:unspliced-genomic cation transporter HKT7, putative, expressed| Length = 5152 Score = 31.3 bits (62), Expect = 5.7 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 / +3 Query: 180 QVFPAAVQMHGRLSDRLHPGMQEVRQVHRRRPRQLPVQG 296 QV AA + HG++ R P + R+ RRR R+ V G Sbjct: 372 QVVQAAERRHGQIPARREPRRRRARRHRRRRRREPDVVG 488
>LOC_Os03g28110:12003.t02484:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4266 Score = 31.3 bits (62), Expect = 5.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 / +2 Query: 283 SCRGRRRWTWRTSCMPGCNRSERR 212 +CR RR+W M GC R +RR Sbjct: 521 TCRSRRQWAASRRTMSGCARRKRR 592
>LOC_Os03g17310:12003.t01509:unspliced-genomic calcium-transporting ATPase 2, endoplasmic reticulum-type, putative,| expressed Length = 7213 Score = 31.3 bits (62), Expect = 5.7 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 / -2 Query: 340 TRP*CSGCCRSW**DPCTGSCRGRRRWTWRTSCMP 236 +RP S SW P +G R R WT RTS P Sbjct: 7179 SRPTSSSTTASWPRSPTSGCPRPGRSWTRRTSAPP 7075
>LOC_Os03g17300:12003.t01508:unspliced-genomic protein kinase, putative, expressed| Length = 4071 Score = 31.3 bits (62), Expect = 5.7 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 / +3 Query: 340 TRP*CSGCCRSW**DPCTGSCRGRRRWTWRTSCMP 236 +RP S SW P +G R R WT RTS P Sbjct: 2271 SRPTSSSTTASWPRSPTSGCPRPGRSWTRRTSAPP 2375
>LOC_Os02g38490:12002.t03487:unspliced-genomic expressed protein| Length = 1969 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 / +2 Query: 413 FPVDSASLSG*MPRRNDSCSSFLLVS 490 FPVDSA+++G P N +C F +S Sbjct: 239 FPVDSATVAGEAPNPNPTCPLFPFIS 316
>LOC_Os01g70870:12001.t06385:unspliced-genomic zinc finger, C2H2 type family protein, expressed| Length = 3758 Score = 31.3 bits (62), Expect = 5.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -3 / +3 Query: 292 CTGSCRGRRRWTWRTSCMPGC 230 C CRGRRR +W S GC Sbjct: 3261 CRRRCRGRRRRSWSGSTWAGC 3323
>LOC_Os01g37630:12001.t03304:unspliced-genomic esterase PIR7B, putative, expressed| Length = 1404 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 / -2 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSER 215 PC G+C R R + R SC P R+ R Sbjct: 398 PCPGACPRRARRSCRRSCGPRARRARR 318
>LOC_Os01g31580:12001.t02740:unspliced-genomic expressed protein| Length = 8679 Score = 31.3 bits (62), Expect = 5.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 / -2 Query: 271 RRRWTWRTSCMPGC 230 RRRW W C+P C Sbjct: 113 RRRWMWMNDCLPAC 72
>LOC_Os07g43670:12007.t04012:unspliced-genomic ribonuclease 1 precursor, putative, expressed| Length = 1454 Score = 31.3 bits (62), Expect = 5.8 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +1 / +2 Query: 136 SQGTTLCCDKCGICTRSFPPQCRCMDVSPTGCIPACKKCAKST 264 S TT T S PP+ RC S T PA + C++ T Sbjct: 965 SPPTTRATPSAASATPSPPPRARCPTSSATATPPARRSCSRCT 1093
>LOC_Os11g05400:12011.t00432:unspliced-genomic expressed protein| Length = 2978 Score = 27.6 bits (54), Expect(2) = 5.9 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 / +1 Query: 286 GSCRGRRRWTWRTSCMPGCNRSERRPCIC 200 G CRGRR RTS R+ RR C Sbjct: 1600 GGCRGRRAARRRTSTTRSTRRAARRTW*C 1686 Score = 24.4 bits (47), Expect(2) = 5.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 / +2 Query: 576 FFFFGSESILHSIPCI 529 FFFF SES S+ C+ Sbjct: 734 FFFFSSESEAKSVLCL 781
>LOC_Os03g08470:12003.t00704:unspliced-genomic root abundant factor, putative, expressed| Length = 1872 Score = 26.7 bits (52), Expect(2) = 7.1 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 / -1 Query: 292 CTGSCRGRRRWT 257 C+ SCRGRR W+ Sbjct: 237 CSCSCRGRRSWS 202 Score = 24.4 bits (47), Expect(2) = 7.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 / -2 Query: 460 ISSRHLPR*RCRVNRK 413 IS+ H P RCR+ RK Sbjct: 590 ISAAHFPHGRCRMPRK 543
>LOC_Os09g21260:12009.t01860:unspliced-genomic taxane 10-beta-hydroxylase, putative, expressed| Length = 1507 Score = 26.7 bits (52), Expect(2) = 7.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 / -1 Query: 280 CRGRRRWTWRTSC 242 C GRRR +WR +C Sbjct: 328 CGGRRRCSWRRAC 290 Score = 24.0 bits (46), Expect(2) = 7.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 / -3 Query: 487 HKKERRARIISSRHLPR 437 H RR R +++RHLP+ Sbjct: 713 HATARRPRRLAARHLPK 663
>LOC_Os12g42950:12012.t03968:unspliced-genomic hypothetical protein| Length = 1086 Score = 30.9 bits (61), Expect = 7.9 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 / -3 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSERRP 209 PCT R RRRW R G R RRP Sbjct: 610 PCTCRRRRRRRWRRRRCGRRGAPRRRRRP 524
>LOC_Os12g12350:12012.t01104:unspliced-genomic conserved hypothetical protein| Length = 456 Score = 30.9 bits (61), Expect = 7.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 / +2 Query: 286 GSCRGRRRWTWRTSCMPGCN 227 G GRRRWTWR S G N Sbjct: 296 GGNAGRRRWTWRLSPSHGGN 355
>LOC_Os10g05088:12010.t00387:unspliced-genomic anther-specific proline-rich protein APG, putative, expressed| Length = 4277 Score = 30.9 bits (61), Expect = 7.9 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -3 / -2 Query: 286 GSCRGRRRWTWRTSCMPGCNRSERRPCICTAA 191 G CRGRR + R RS R C CTAA Sbjct: 3472 GCCRGRRGRS*RRRASR*AGRSPARACGCTAA 3377
>LOC_Os10g01330:12010.t00029:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1803 Score = 30.9 bits (61), Expect = 7.9 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 / +3 Query: 283 SCRGRRRWTWRTSCMPGCNRS 221 SC+ R W+W TSC P R+ Sbjct: 654 SCQRSRGWSWFTSCRPQLGRA 716
>LOC_Os09g38090:12009.t03283:unspliced-genomic expressed protein| Length = 3084 Score = 30.9 bits (61), Expect = 7.9 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +3 / +3 Query: 189 PAAVQMHGRLSDRLHPGMQEVRQVHRRR 272 PA V+ R DR HPG Q RQ RRR Sbjct: 2391 PAPVRGGRRAVDRDHPGRQNRRQRRRRR 2474
>LOC_Os09g06520:12009.t00449:unspliced-genomic hypothetical protein| Length = 3969 Score = 30.9 bits (61), Expect = 7.9 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 / -2 Query: 507 FFPQNLHVCTEWNAIWIQI 563 FF +NLHV +WN I IQI Sbjct: 581 FFLENLHVSGDWNPIPIQI 525
>LOC_Os08g16320:12008.t01506:unspliced-genomic cytochrome P450 86A1, putative| Length = 1503 Score = 30.9 bits (61), Expect = 7.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 / -3 Query: 274 GRRRWTWRTSCMPGCNRSER 215 GR R W C PGC RS R Sbjct: 385 GRARRPW*RGCRPGCRRSRR 326
>LOC_Os08g10080:12008.t00893:unspliced-genomic NAC domain-containing protein 21/22, putative, expressed| Length = 3785 Score = 30.9 bits (61), Expect = 7.9 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 / +1 Query: 289 TGSCRGRRRWTWRTSCMPGCNRSERRPCICTAA 191 +GS RG W W TSC + C AA Sbjct: 130 SGSTRGTTSWCWTTSCTSSPPAAGEEGCTAAAA 228
>LOC_Os08g09770:12008.t00862:unspliced-genomic luminal-binding protein 2 precursor, putative, expressed| Length = 2116 Score = 30.9 bits (61), Expect = 7.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 / +2 Query: 259 TWRTSCMPGCNRSERRPCICTAA 191 +WRT P C RS R P AA Sbjct: 1913 SWRTCATPSCRRSTRGPAAAAAA 1981
>LOC_Os07g32630:12007.t02945:unspliced-genomic hydroquinone glucosyltransferase, putative, expressed| Length = 1962 Score = 30.9 bits (61), Expect = 7.9 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -3 / +3 Query: 277 RGRRRWTWRTSCMPGCNRSERRPCICTAA 191 R RR + RTS G RS RRPC +A+ Sbjct: 972 RSPRRRSSRTSACGGWTRSPRRPCCSSAS 1058
>LOC_Os07g32060:12007.t02891:unspliced-genomic anthocyanidin 5,3-O-glucosyltransferase, putative, expressed| Length = 1848 Score = 30.9 bits (61), Expect = 7.9 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 / +3 Query: 322 GCCRSW**DPCTGSCRGRRRWTWR 251 G C S PC+ SC G RRWT R Sbjct: 519 GTCSSRPPPPCSRSCCGCRRWTRR 590
>LOC_Os07g28990:12007.t02589:unspliced-genomic expressed protein| Length = 489 Score = 30.9 bits (61), Expect = 7.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 / +2 Query: 283 SCRGRRRWTWRTSCMPGCNRS 221 S RR W WRT+C C+ S Sbjct: 425 STTSRRPWRWRTACCGSCSSS 487
>LOC_Os06g07790:12006.t00661:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6299 Score = 30.9 bits (61), Expect = 7.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 / +1 Query: 289 TGSCRGRRRWTWRTSCMPGCNRSERRPCIC 200 T R RW+WR SC+ G RR C Sbjct: 2887 TRRSRSATRWSWRRSCVRGSATPPRRRTPC 2976
>LOC_Os06g07270:12006.t00610:unspliced-genomic hypothetical protein| Length = 1332 Score = 30.9 bits (61), Expect = 7.9 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -3 / +2 Query: 283 SCRGRRRWTWRTSCMPGCNRSERRPCIC 200 S R RR W WR+ C R RR C Sbjct: 20 SRRCRRLWRWRSGSRSRCERQHRRRQFC 103
>LOC_Os06g04130:12006.t00304:unspliced-genomic protein GPR108 precursor, putative, expressed| Length = 4684 Score = 30.9 bits (61), Expect = 7.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 / -3 Query: 298 DPCTGSCRGRRRWTWRTSCMPGCNRSERRP 209 DP G R RR WR G R+ RRP Sbjct: 452 DPAAGGGRAPRRRAWRGRIPAGRGRARRRP 363
>LOC_Os04g42840:12004.t03830:unspliced-genomic HEAT repeat family protein, expressed| Length = 11350 Score = 30.9 bits (61), Expect = 7.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 449 PRRNDSCSSFLLVSEINNIFFSAKSSCMHG 538 P + SC SF L + + FFS S C HG Sbjct: 11058 PCVSSSCPSFSLCVIMYSFFFSTSSFCQHG 11147
>LOC_Os04g38910:12004.t03461:unspliced-genomic atypical receptor-like kinase MARK, putative, expressed| Length = 2511 Score = 30.9 bits (61), Expect = 7.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 / +2 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSERRPC 206 P T C R WT R P C RS R C Sbjct: 1880 PRTPCCTTTRAWTCRGGRAPSCGRSGRPRC 1969
>LOC_Os03g49830:12003.t04330:unspliced-genomic expressed protein| Length = 2067 Score = 30.9 bits (61), Expect = 7.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 / -2 Query: 265 RWTWRTSCMPGCNRSERRPCICTAAG 188 R WR+SC+ +RR C+ +AAG Sbjct: 1610 RTLWRSSCLSRQREVKRRSCLVSAAG 1533
>LOC_Os03g15080:12003.t01294:unspliced-genomic expressed protein| Length = 988 Score = 30.9 bits (61), Expect = 7.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 / -1 Query: 292 CTGSCRGRRRWTWRTSCMPGCNRSERRPCICTA 194 CT GR W R P C S RR C C A Sbjct: 433 CTWDGAGRA*WGRRRGGRPWCPASSRRGCWCRA 335
>LOC_Os03g08500:12003.t00707:unspliced-genomic ethylene-responsive element binding protein 2, putative, expressed| Length = 1346 Score = 30.9 bits (61), Expect = 7.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 / -2 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSERR 212 PC G R RRRW+ R GC + RR Sbjct: 991 PCPGRRRRRRRWSARRRR*TGCPGTRRR 908
>LOC_Os02g40700:12002.t03706:unspliced-genomic enzyme of the cupin superfamily, putative, expressed| Length = 1002 Score = 30.9 bits (61), Expect = 7.9 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 / +1 Query: 231 HPGMQEVRQVHRRRPRQLP 287 H G+ VR V RRRPR+LP Sbjct: 523 HQGLVGVRGVRRRRPRRLP 579
>LOC_Os01g69230:12001.t06276:unspliced-genomic protein binding protein, putative, expressed| Length = 3256 Score = 30.9 bits (61), Expect = 7.9 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 / -3 Query: 289 TGSCRGRRRWTWRTS 245 +GSCR RR W+WR + Sbjct: 167 SGSCRRRRSWSWRAT 123
>LOC_Os01g65750:12001.t05937:unspliced-genomic transposon protein, putative, unclassified| Length = 2173 Score = 30.9 bits (61), Expect = 7.9 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -2 / +3 Query: 227 PVGETSMHLHCGGKDLVQMPHLSQHSVVP 141 P TSMH C K L Q+PH S VP Sbjct: 708 PRPATSMHARCSTKCLAQVPHRSALVPVP 794
>LOC_Os01g41834:12001.t03704:unspliced-genomic chalcone synthase 4, putative| Length = 3743 Score = 30.9 bits (61), Expect = 7.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 / +1 Query: 328 CSGCCRSW**DPCTGSCRGR 269 C C R PCTG+CRGR Sbjct: 3295 CRSCGRRGSCSPCTGTCRGR 3354
>LOC_Os01g25960:12001.t02306:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 3207 Score = 30.9 bits (61), Expect = 7.9 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 / +1 Query: 287 WKLSRPPTVDLAHFLHAGMQP 225 W SRPPT+DL HF + P Sbjct: 2851 WLPSRPPTLDLTHFRPQPLSP 2913
>LOC_Os01g07300:12001.t00609:unspliced-genomic expressed protein| Length = 1435 Score = 30.9 bits (61), Expect = 7.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 / -1 Query: 295 PCTGSCRGRRRWTWRTSCMPGCNRSERRP 209 P T S RW WR SC P RRP Sbjct: 916 PATRSPASSSRW*WRRSCSPPWGA*ARRP 830
>LOC_Os01g04040:12001.t00293:unspliced-genomic Bowman-Birk type wound-induced proteinase inhibitor WIP1 precursor,| putative Length = 919 Score = 30.9 bits (61), Expect = 7.9 Identities = 11/33 (33%), Positives = 12/33 (36%) Frame = +1 / +2 Query: 229 CIPACKKCAKSTVGGRDSFQCKDLITNFCNTRC 327 C P CK CA F+C D C C Sbjct: 812 CDPVCKSCAVVKTHPVKKFKCTDTFLGMCGPPC 910
>LOC_Os01g03310:12001.t00223:unspliced-genomic Bowman-Birk type bran trypsin inhibitor precursor, putative,| expressed Length = 906 Score = 30.9 bits (61), Expect = 7.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 / +2 Query: 157 CDKCGICTRSFPPQCRCMD 213 C +CT+S PP C C D Sbjct: 455 CCDIAVCTKSLPPICHCSD 511
>LOC_Os01g45090:12001.t03968:unspliced-genomic transcription factor MYB21, putative, expressed| Length = 1196 Score = 25.8 bits (50), Expect(2) = 8.6 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -3 / +3 Query: 280 CRGRRRWTWRTSCMPGCNRSERR 212 CR R R W +C P R RR Sbjct: 486 CRSRARTPWAWACPPPPARRRRR 554 Score = 24.4 bits (47), Expect(2) = 8.6 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 / +3 Query: 325 SGCCRSW**DPCTGSCRGRRRWTW 254 +GC S * P G RRR TW Sbjct: 276 AGCGGSTT*GPVCGGAASRRRRTW 347
>LOC_Os05g38350:12005.t03377:unspliced-genomic glycerol-3-phosphate acyltransferase 8, putative, expressed| Length = 2808 Score = 24.9 bits (48), Expect(2) = 9.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +2 Query: 283 SCRGRRRWTWRTSCMP 236 +CR RR WR C P Sbjct: 242 ACRARRWRPWRAPCCP 289 Score = 22.6 bits (43), Expect(2) = 9.7 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = -3 / +2 Query: 337 RP*CSGCCRSW**DPCTGSCRGR 269 RP C G R W C G GR Sbjct: 122 RPGCRGSRRCWRCGRCCGRWSGR 190
>LOC_Os02g58530:12002.t05423:unspliced-genomic major facilitator superfamily protein, expressed| Length = 1959 Score = 26.3 bits (51), Expect(2) = 9.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 / -3 Query: 283 SCRGRRRWTWRTSCMPGCNRSERRP 209 SCRG RR WR C R P Sbjct: 97 SCRGERRRWWRCPIPEACCRPPPPP 23 Score = 24.4 bits (47), Expect(2) = 9.9 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 / -2 Query: 319 CCRSW**DPCTGSCR 275 CCR W P T +CR Sbjct: 1310 CCRIWIATPHTSACR 1266 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 217,819,621 Number of extensions: 3867476 Number of successful extensions: 26370 Number of sequences better than 10.0: 146 Length of query: 193 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 145 Effective length of database: 52,912,542 Effective search space: 7672318590 Effective search space used: 7672318590 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
