| Clone Name | FLbaf74n07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q78JW9:UBFD1_MOUSE Ubiquitin domain-containing protein UBFD1 - M... | 34 | 2.0 | 2 | O14562:UBFD1_HUMAN Ubiquitin domain-containing protein UBFD1 - H... | 34 | 2.0 | 3 | P03290:Y115_ADE02 Hypothetical protein E-115 - Human adenovirus ... | 33 | 4.5 | 4 | Q5T5P2:SKT_HUMAN Sickle tail protein homolog - Homo sapiens (Human) | 32 | 5.9 |
|---|
>Q78JW9:UBFD1_MOUSE Ubiquitin domain-containing protein UBFD1 - Mus musculus (Mouse)| Length = 368 Score = 33.9 bits (76), Expect = 2.0 Identities = 20/81 (24%), Positives = 36/81 (44%) Frame = +1 Query: 367 PSGMLVQKRTPDSDPPPGGAPVPTIRVKVKYAGVYHEVYINSQASFGELKKLMSEKTGLH 546 P Q + + GG + +K+ + H+V + ++ ELK+ + TGL Sbjct: 121 PGDPAAQASVSNGEDAGGGVGKELVDLKIIWNKTKHDVKVPLDSTGSELKQKIHSITGLP 180 Query: 547 PDDQKVVYKDRERDSKAFLDM 609 P QKV+YK + K ++ Sbjct: 181 PAMQKVMYKGLVPEDKTLREI 201
>O14562:UBFD1_HUMAN Ubiquitin domain-containing protein UBFD1 - Homo sapiens (Human)| Length = 533 Score = 33.9 bits (76), Expect = 2.0 Identities = 21/81 (25%), Positives = 36/81 (44%) Frame = +1 Query: 367 PSGMLVQKRTPDSDPPPGGAPVPTIRVKVKYAGVYHEVYINSQASFGELKKLMSEKTGLH 546 P Q + + GGA + +K+ + H+V ++ ELK+ + TGL Sbjct: 286 PGDPAAQASVSNGEDAGGGAGRELVDLKIIWNKTKHDVKFPLDSTGSELKQKIHSITGLP 345 Query: 547 PDDQKVVYKDRERDSKAFLDM 609 P QKV+YK + K ++ Sbjct: 346 PAMQKVMYKGLVPEDKTLREI 366
>P03290:Y115_ADE02 Hypothetical protein E-115 - Human adenovirus 2 (HAdV-2)| Length = 115 Score = 32.7 bits (73), Expect = 4.5 Identities = 22/71 (30%), Positives = 27/71 (38%) Frame = -1 Query: 1300 PMNVYTHVAGGWPHPAGTSRRAPTRTSGTARWWSRAPWWTPVPMTMKRARRTAGRTYPSW 1121 P+ V T P A + RA R T WS A W T T + + W Sbjct: 45 PLKVCTAPRAAPPPRASCAPRATPRRGWTMTPWSNATWPTRRAKTGSASAPAGPASSAPW 104 Query: 1120 PSRSVARGRSP 1088 P+RS R SP Sbjct: 105 PARSPERTPSP 115
>Q5T5P2:SKT_HUMAN Sickle tail protein homolog - Homo sapiens (Human)| Length = 1943 Score = 32.3 bits (72), Expect = 5.9 Identities = 36/153 (23%), Positives = 59/153 (38%), Gaps = 2/153 (1%) Frame = +1 Query: 382 VQKRTPDSDPPPGGAPVPTIRVKVKYAGVYHEVYINSQASFGELKKLMSEKTGLHPDDQK 561 ++ P S PPP G H + + S EL+ + + L +Q+ Sbjct: 625 LESTVPPSQPPPVGT------------SAIHMSLLEMRRSVAELRLQLQQMRQLQLQNQE 672 Query: 562 VVYKDRERDSKAFLDMVGVKDRSKMTLLEDPTAQAKRLIEERRNXXXXXXXXXXXXXXLD 741 ++ R KA L++ G K M LEDP + + L+E+ R + Sbjct: 673 LL---RAMMKKAELEISG-KVMETMKRLEDPVQRQRVLVEQERQKYLH-----------E 717 Query: 742 VDKLASKVSALETIVS--KGGKVVEADLVTLTE 834 +K+ K+ LE V K + LVTL + Sbjct: 718 EEKIVKKLCELEDFVEDLKKDSTAASRLVTLKD 750 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 185,817,698 Number of extensions: 3601476 Number of successful extensions: 11432 Number of sequences better than 10.0: 4 Number of HSP's gapped: 11416 Number of HSP's successfully gapped: 4 Length of query: 539 Length of database: 100,686,439 Length adjustment: 118 Effective length of query: 421 Effective length of database: 68,319,629 Effective search space: 28762563809 Effective search space used: 28762563809 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)