ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf73e06 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os08g01380:12008.t00038:unspliced-genomic ferredoxin-1, chloroplast precursor, putative, expressed| Length = 956 Score = 142 bits (304), Expect = 3e-33 Identities = 62/102 (60%), Positives = 69/102 (67%) Frame = +2 / +3 Query: 191 GMRLRAQATYKVKLITPEGEVDLEVPDDVYILDHAEEEGIDLPYXXXXXXXXXXXXKVVS 370 G RLR QATY VKLITP+GEV+L+VPDDVYILD AEEEGIDLPY KVVS Sbjct: 198 GDRLRMQATYNVKLITPDGEVELQVPDDVYILDQAEEEGIDLPYSCRAGSCSSCAGKVVS 377 Query: 371 GXXXXXXXXXXXXXXIEAGWVLTCAAYPTSDLVIETHKEEEL 496 G + AGWVLTC AYP SD+VIETHKE++L Sbjct: 378 GEIDQSDQSFLDDDQVAAGWVLTCHAYPKSDVVIETHKEDDL 503 Score = 59.3 bits (123), Expect(2) = 1e-10 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = +1 / +2 Query: 385 VRPELPRRRPDRGGVGAHLRRVPHLGPRHRDTQGGGAHRLN 507 VRPELPRRRP +G HL R+P + RHRD QGG H +N Sbjct: 392 VRPELPRRRPGCRRLGPHLPRLPQVRRRHRDPQGGRPHLIN 514 Score = 29.0 bits (57), Expect(2) = 1e-10 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 / +2 Query: 148 GIPRRAPAVVDGCQGHEAPRAGDVQGEADH 237 G R A + G +A AGDVQ EADH Sbjct: 155 GAGARVGAAGEQQAGRQAADAGDVQREADH 244 Score = 36.8 bits (74), Expect(3) = 1e-08 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -2 / -1 Query: 253 HLALRRDQLHLVRRLRAEPHAPGSRRRQ 170 HLA+R DQLH+VRRL +P + RRQ Sbjct: 260 HLAVRCDQLHVVRRLHPQPVSQLVARRQ 177 Score = 36.3 bits (73), Expect(3) = 1e-08 Identities = 20/44 (45%), Positives = 23/44 (52%) Frame = -3 / -2 Query: 492 SSSLCVSMTRSEVGYAAQVSTHPASIXXXXXXXXXXXXXWPETT 361 SSSL VSMT S++G A QV T PA+ PETT Sbjct: 499 SSSLWVSMTTSDLG*AWQVRTQPAATWSSSRKLWSDWSISPETT 368 Score = 22.1 bits (42), Expect(3) = 1e-08 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 / -1 Query: 370 GDHLPXXXXXXXXXXGVGQVDPF 302 GDHL GV QVDPF Sbjct: 377 GDHLAGAGGAGARAAGVRQVDPF 309 Score = 34.5 bits (69), Expect = 0.76 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 / -2 Query: 237 VISFTLYVACARSLMP 190 VISFTLYVAC RSL P Sbjct: 244 VISFTLYVACIRSLSP 197
>LOC_Os01g64120:12001.t05780:unspliced-genomic ferredoxin-6, chloroplast precursor, putative, expressed| Length = 949 Score = 86.3 bits (182), Expect(2) = 5e-18 Identities = 38/83 (45%), Positives = 47/83 (56%) Frame = +2 / +1 Query: 248 EVDLEVPDDVYILDHAEEEGIDLPYXXXXXXXXXXXXKVVSGXXXXXXXXXXXXXXIEAG 427 E +LEVP+D Y+LD AEE G++LPY K+ SG IE G Sbjct: 541 ESELEVPEDTYVLDAAEEAGLELPYSCRAGSCSTCAGKLASGEVDQSDGSFLADEQIEQG 720 Query: 428 WVLTCAAYPTSDLVIETHKEEEL 496 +VLTC +YP SD VI THKEEE+ Sbjct: 721 YVLTCISYPKSDCVIYTHKEEEV 789 Score = 24.4 bits (47), Expect(2) = 5e-18 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 / +1 Query: 197 RLRAQATYKVKLITPEG 247 R A A +KVKLI P+G Sbjct: 487 RASAAAVHKVKLIGPDG 537 Score = 36.8 bits (74), Expect = 0.16 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = -3 / -3 Query: 495 SSSSLCVSMTRSEVGYAAQVSTHPASI 415 +SSSL V MT+S++GY VST+P SI Sbjct: 788 TSSSLWV*MTQSDLGYEMHVSTYPCSI 708
>LOC_Os04g33630:12004.t03039:unspliced-genomic ferredoxin-3, chloroplast precursor, putative, expressed| Length = 3606 Score = 83.5 bits (176), Expect(2) = 9e-18 Identities = 36/80 (45%), Positives = 46/80 (57%) Frame = +2 / +3 Query: 257 LEVPDDVYILDHAEEEGIDLPYXXXXXXXXXXXXKVVSGXXXXXXXXXXXXXXIEAGWVL 436 ++VP+D YILD AEE G+DLPY KVV G + AG+VL Sbjct: 3174 IKVPEDTYILDAAEEAGVDLPYSCRAGACSTCAGKVVEGGVDQSDQSFLDDAQVGAGYVL 3353 Query: 437 TCAAYPTSDLVIETHKEEEL 496 TC AYPT++ VI+THKE +L Sbjct: 3354 TCVAYPTANSVIQTHKEADL 3413 Score = 26.3 bits (51), Expect(2) = 9e-18 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 / +3 Query: 173 SSTAARGMRLRAQATYKVKLITPEGE 250 SS A + A A Y VKLI PEG+ Sbjct: 3087 SSRARGDLIRAAAAVYTVKLIGPEGQ 3164 Score = 49.2 bits (101), Expect(2) = 3e-05 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +1 / +2 Query: 385 VRPELPRRRPDRGGVGAHLRRVPHLGPRHRDTQGG 489 V P +PRRRP R + AHLRRVP RH D QGG Sbjct: 3302 VGPVVPRRRPGRRRLRAHLRRVPDRQQRHPDAQGG 3406 Score = 22.6 bits (43), Expect(2) = 3e-05 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 / +3 Query: 155 RVALPLSSTAARGMRLRAQA 214 R L LSS+ ARG +RA A Sbjct: 3066 RTTLHLSSSRARGDLIRAAA 3125 Score = 36.8 bits (74), Expect = 0.16 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -3 / -3 Query: 492 SSSLCVSMTRSEVGYAAQVSTHPA 421 S+SLCV MT VGYA QVST PA Sbjct: 3409 SASLCVWMTLLAVGYATQVST*PA 3338
>LOC_Os03g61960:12003.t05424:unspliced-genomic ferredoxin-3, chloroplast precursor, putative, expressed| Length = 1917 Score = 45.1 bits (92), Expect(3) = 9e-17 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = +2 / +2 Query: 419 EAGWVLTCAAYPTSDLVIETHKEEEL 496 E G+VLTC +YP SD VI THKE +L Sbjct: 1553 EEGYVLTCVSYPKSDCVIHTHKEGDL 1630 Score = 41.4 bits (84), Expect(3) = 9e-17 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +2 / +2 Query: 248 EVDLEVPDDVYILDHAEEEGIDLPYXXXXXXXXXXXXKVVSG 373 E + E PDD YILD AE G++LPY K+ +G Sbjct: 1382 EHEFEAPDDTYILDAAETAGVELPYSCRAGACSTCAGKIEAG 1507 Score = 37.3 bits (75), Expect(3) = 9e-17 Identities = 19/64 (29%), Positives = 34/64 (53%) Frame = +2 / +2 Query: 59 LARSSAAMATVVSSLRLPFSVCAAAPSAPMASRVALPLSSTAARGMRLRAQATYKVKLIT 238 LA S +++ + +V + A + + + P +++ + + A ATYKVKLIT Sbjct: 1190 LATSCVSLSNARTQASKVAAVKSPASLSFFSQGMQFPSLKASSKKLDVSAMATYKVKLIT 1369 Query: 239 PEGE 250 PEG+ Sbjct: 1370 PEGQ 1381
>LOC_Os05g37140:12005.t04654:unspliced-genomic ferredoxin-6, chloroplast precursor, putative, expressed| Length = 1549 Score = 46.0 bits (94), Expect(3) = 4e-12 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = +2 / +2 Query: 425 GWVLTCAAYPTSDLVIETHKEEEL 496 G+VLTC +YP +D VI THKEEEL Sbjct: 1103 GYVLTCISYPKADCVIHTHKEEEL 1174 Score = 36.3 bits (73), Expect(3) = 4e-12 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 / +2 Query: 248 EVDLEVPDDVYILDHAEEEGIDLPYXXXXXXXXXXXXKVVSG 373 E + E P+D YIL+ AE G++LP+ K+ SG Sbjct: 926 EHEFEAPEDTYILEAAETAGVELPFSCRAGSCSTCAGKMSSG 1051 Score = 25.4 bits (49), Expect(3) = 4e-12 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 / +2 Query: 197 RLRAQATYKVKLITPEG 247 R+ A A +KVKLI P+G Sbjct: 872 RVSATAVHKVKLIGPDG 922 Score = 34.5 bits (69), Expect = 0.76 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 / +1 Query: 397 LPRRRPDRGGVGAHLRRVPHLGPRHRDTQGG 489 LPRR PD G+ + + VP G RH QGG Sbjct: 1075 LPRREPDGRGIRSDMHFVP*GGLRHSHPQGG 1167 Score = 32.7 bits (65), Expect = 2.7 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -3 / -2 Query: 495 SSSSLCVSMTRSEVGYAAQVSTHPASI 415 SSSSL V MT+S +GY V T+P+ I Sbjct: 1173 SSSSLWV*MTQSALGYEMHVRTYPSPI 1093
>LOC_Os02g13290:12002.t01126:unspliced-genomic phosphoethanolamine/phosphocholine phosphatase, putative, expressed| Length = 1325 Score = 37.7 bits (76), Expect(2) = 0.002 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 / +1 Query: 388 RPELPRRRPDRGGVGAHLRRVPHLGPRHR 474 RP + R RGG H RRVPH+G R R Sbjct: 826 RPRVGGLRGPRGGAARHRRRVPHVGTRRR 912 Score = 26.3 bits (51), Expect(2) = 0.002 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +2 / +2 Query: 59 LARSSAAMATVVSSLRLPFSVCAAAPSAPMASRVALPLSSTAARGMRLR 205 L+ A M + + R V A+ +AP++ RVA + + A G LR Sbjct: 278 LSFQDAMMGELHAEGRTVEEVAASLRAAPLSPRVAAAVETARALGCELR 424
>LOC_Os03g45710:12003.t03943:unspliced-genomic ferredoxin, chloroplast precursor, putative, expressed| Length = 917 Score = 32.2 bits (64), Expect(2) = 0.013 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 / +1 Query: 416 IEAGWVLTCAAYPTSDLVIETHKEEEL 496 + G+ L CA+YP SD I E+EL Sbjct: 421 VAQGYALLCASYPRSDCTIRVIPEDEL 501 Score = 25.8 bits (50), Expect(2) = 0.013 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 / +1 Query: 257 LEVPDDVYILDHAEEEGIDLPYXXXXXXXXXXXXKVVSG 373 +EV + IL A +EGID+P+ ++V+G Sbjct: 265 VEVEEGETILSRALDEGIDVPHDCKLGVCMTCPARLVAG 381
>LOC_Os08g27100:12008.t02474:unspliced-genomic hypothetical protein| Length = 1144 Score = 33.1 bits (66), Expect(2) = 0.10 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 / +1 Query: 80 MATVVSSLRLPFSVCAAAPSAPMASRVALPLSSTAARGMRLR 205 MAT+ +L + CAA +AP SR P + A+ G RLR Sbjct: 1 MATLPQRFKLLATRCAAGAAAPSPSRSPAPSYAGASPGYRLR 126 Score = 24.4 bits (47), Expect(2) = 0.10 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 / +1 Query: 397 LPRRRPDRGGVGAHLRR 447 L RRR RGGV LRR Sbjct: 121 LRRRRRRRGGVDGRLRR 171
>LOC_Os12g41160:12012.t03793:unspliced-genomic IQ calmodulin-binding motif family protein, expressed| Length = 2917 Score = 37.3 bits (75), Expect = 0.11 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 / -1 Query: 385 VRPELPRRRPDRGGVGAHLRRVPHLGPRHRDTQGGG 492 V P PR R R G GA LRR P D GGG Sbjct: 2824 VHPHCPRARRARAGAGARLRRAPLHARADADAGGGG 2717
>LOC_Os05g04110:12005.t00307:unspliced-genomic hypothetical protein| Length = 414 Score = 36.8 bits (74), Expect = 0.16 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = +2 / +1 Query: 128 AAPSAPMASRVALPLSSTAARGMRLRAQAT 217 AAPS P RV LP++S+++RG+R R + T Sbjct: 4 AAPSPPCLLRVLLPVASSSSRGLRRRRRPT 93
>LOC_Os10g09430:12010.t00759:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4054 Score = 36.3 bits (73), Expect = 0.21 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPMASRVAL 166 RSS M +VSS LP S C PS P+ SR++L Sbjct: 1844 RSSWKMKALVSSSCLPSSACGRRPSLPLFSRLSL 1945
>LOC_Os11g22430:12011.t01914:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 7027 Score = 35.9 bits (72), Expect = 0.29 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 / +1 Query: 47 YLPELARSSAAMATVVSSLRLPFSVCAAAPSAPMAS 154 + P RSS M +VSSL LP S C PS P+ S Sbjct: 1159 FSPTQKRSSWKMKALVSSLCLPSSACGRRPSLPLFS 1266
>LOC_Os03g59570:12003.t05203:unspliced-genomic cytokinin synthase, putative, expressed| Length = 1789 Score = 35.9 bits (72), Expect = 0.29 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +1 / +2 Query: 391 PELPRRRPDRGGVGAHLRR 447 P LPRRR RGG GAH RR Sbjct: 812 PPLPRRRRRRGGAGAHARR 868
>LOC_Os02g19670:12002.t01759:unspliced-genomic conserved hypothetical protein| Length = 2086 Score = 35.9 bits (72), Expect = 0.29 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 / +1 Query: 47 YLPELARSSAAMATVVSSLRLPFSVCAAAPSAPMAS 154 + P RSS M +VSSL LP S C PS P+ S Sbjct: 685 FSPTQKRSSWKMKALVSSLCLPSSACGRRPSLPLFS 792
>LOC_Os11g43950:12011.t03925:unspliced-genomic auxilin-like protein, putative, expressed| Length = 6463 Score = 31.8 bits (63), Expect(2) = 0.37 Identities = 19/43 (44%), Positives = 23/43 (53%) Frame = +2 / -1 Query: 62 ARSSAAMATVVSSLRLPFSVCAAAPSAPMASRVALPLSSTAAR 190 AR+ A SS L FS+ AAA +A SR + STAAR Sbjct: 3208 ARAPAPKKDSRSSAELCFSLAAAAAAAACLSRASAAALSTAAR 3080 Score = 26.3 bits (51), Expect(2) = 0.37 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 / -1 Query: 448 VPHLGPRHRDTQGGGAHR 501 V H GPR R +GGG R Sbjct: 472 VVHRGPRRRRRRGGGGSR 419
>LOC_Os10g28530:12010.t02204:unspliced-genomic hypothetical protein| Length = 312 Score = 35.4 bits (71), Expect = 0.40 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -3 / -2 Query: 192 PLAAVDDSGSATRDAMGAEGAAAQTEKGKRRLLTTVAIAAELRASSGR 49 P ++G+ + +MGA A Q + +RRL +AAE RA + R Sbjct: 293 PAVVAAEAGAGAQRSMGASRARRQRAEPRRRLRMPAVVAAETRAGAWR 150
>LOC_Os01g62300:12001.t05605:unspliced-genomic SLT1 protein, putative, expressed| Length = 2483 Score = 35.4 bits (71), Expect = 0.40 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 / -1 Query: 134 PSAPMASRVALPLSSTAARGMRLRAQATYKVKLITP 241 P P+ASRV LPL +A+RG++ + ++++P Sbjct: 1007 PDTPLASRVTLPLHLSASRGLK*NVKKNQAPQMLSP 900
>LOC_Os06g22210:12006.t02036:unspliced-genomic transposon protein, putative, unclassified| Length = 1305 Score = 33.1 bits (66), Expect(2) = 0.52 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +2 / -3 Query: 47 YLPELARSSAAMATVVSSLRLPFSVCAAAPSAPM 148 + P RSS M +VSS LP S C PS P+ Sbjct: 385 FFPTQKRSSWRMKALVSSSCLPSSACGRRPSLPL 284 Score = 22.1 bits (42), Expect(2) = 0.52 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 283 FPVCLCVC 260
>LOC_Os12g22310:12012.t01970:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2394 Score = 35.0 bits (70), Expect = 0.55 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 / +1 Query: 47 YLPELARSSAAMATVVSSLRLPFSVCAAAPSAPMAS 154 + P RSS M +VSSL LP S C PS P+ S Sbjct: 685 FSPT*KRSSYKMKALVSSLCLPQSACGRRPSLPLFS 792
>LOC_Os07g17220:12007.t01582:unspliced-genomic disease resistance protein, putative, expressed| Length = 3628 Score = 35.0 bits (70), Expect = 0.55 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 / -2 Query: 391 PELPRRRPDRGGVGAHLRRVPHLGPRHRDTQGGGA 495 P +PRRR G + L R P P+ R + GGGA Sbjct: 525 PAVPRRRRALAGASSDLTRSPRTSPKCRRSCGGGA 421
>LOC_Os04g10100:12004.t00843:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6726 Score = 35.0 bits (70), Expect = 0.55 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPMASRVAL 166 RSS M +VSS LP S C PS P+ R++L Sbjct: 725 RSSLKMKALVSSSCLPSSACGLRPSLPLLLRLSL 826
>LOC_Os04g06470:12004.t00521:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4462 Score = 35.0 bits (70), Expect = 0.55 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPMASRVAL 166 RSS M +VSS LP S C PS P+ R++L Sbjct: 725 RSSLKMKVLVSSSCLPSSACGRRPSLPLLLRLSL 826
>LOC_Os02g57560:12002.t05327:unspliced-genomic calcium/calmodulin-regulated receptor-like kinase, putative,| expressed Length = 2188 Score = 35.0 bits (70), Expect = 0.55 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 / +2 Query: 406 RRPDRGGVGAHLRRVPHLGPRHR 474 RR RG V AH+RR PH PRH+ Sbjct: 1301 RRRARGDVPAHVRRSPHHPPRHQ 1369
>LOC_Os07g06080:12007.t00490:unspliced-genomic D-amino acid oxidase, putative, expressed| Length = 2069 Score = 30.9 bits (61), Expect(2) = 0.59 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 / -3 Query: 388 RPELPRRRPDRGGV 429 RPELPRRR RGGV Sbjct: 450 RPELPRRRGGRGGV 409 Score = 24.9 bits (48), Expect(2) = 0.59 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 / -1 Query: 68 SSAAMATVVSSLRLPFSVCAAAPSAPMASRVA 163 SSA A V +LR+P +C A P ++ Sbjct: 1205 SSARAAPVAGALRIPQQLCPVAT*QPFTPGIS 1110
>LOC_Os03g48040:12003.t05706:unspliced-genomic ferredoxin-6, chloroplast precursor, putative, expressed| Length = 3046 Score = 34.1 bits (68), Expect(2) = 0.62 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 / +2 Query: 425 GWVLTCAAYPTSDLVIETHKEEE 493 G+ L C +PTSD+ +ET E+E Sbjct: 2135 GYALLCVGFPTSDVEVETQDEDE 2203 Score = 22.1 bits (42), Expect(2) = 0.62 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 / +2 Query: 272 DVYILDHAEEEGIDLPY 322 D YIL AE + I LP+ Sbjct: 527 DQYILHTAEAQDITLPF 577
>LOC_Os10g19150:12010.t01461:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 860 Score = 29.0 bits (57), Expect(2) = 0.66 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 / +3 Query: 406 RRPDRGGVGAHLRRVPHLGP 465 +RPD GG+GA RR +GP Sbjct: 354 KRPDWGGIGAARRRGGRVGP 413 Score = 23.1 bits (44), Expect(2) = 0.66 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 / +1 Query: 529 IRFRRARVYARCMNCIRILRSYRVI 603 +R RRA V R C+RI+ ++++ Sbjct: 499 VRRRRAVVLQRYSICLRIIYDHKLL 573
>LOC_Os05g19520:12005.t01718:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3675 Score = 30.4 bits (60), Expect(2) = 0.73 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 1452 RSSWKMKALVSSSCLPSSACGRRPSLPL 1369 Score = 25.8 bits (50), Expect(2) = 0.73 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 / -3 Query: 131 APSAPMASRVALPLSSTAARGMRLR 205 +P +P S A PLS++AA RLR Sbjct: 508 SPHSPKPSIAATPLSASAAAYHRLR 434
>LOC_Os06g43520:12006.t04042:unspliced-genomic cytochrome P450 71D7, putative, expressed| Length = 5039 Score = 34.5 bits (69), Expect = 0.76 Identities = 21/58 (36%), Positives = 29/58 (50%) Frame = -3 / -2 Query: 225 TLYVACARSLMPLAAVDDSGSATRDAMGAEGAAAQTEKGKRRLLTTVAIAAELRASSG 52 TL VAC+ + L AV S SA + A A+ K KRRL + ++ A A+ G Sbjct: 4759 TLTVACSHRSLFLLAVIPSPSAMSSSPAAVPPASSQSKWKRRLASPSSMMATANATPG 4586
>LOC_Os04g42250:12004.t03778:unspliced-genomic anthranilate N-benzoyltransferase protein 2, putative, expressed| Length = 5769 Score = 34.5 bits (69), Expect = 0.76 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 / +1 Query: 565 MNCIRILRSYRVISTCCCGRNLIAY*CLC 651 ++CIR R + + CCGR L *CLC Sbjct: 1081 ISCIRCTVPSRQLMSFCCGRGLFLV*CLC 1167
>LOC_Os03g61319:12003.t05364:unspliced-genomic no apical meristem protein| Length = 951 Score = 34.5 bits (69), Expect = 0.76 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = -3 / -2 Query: 174 DSGSATRDAMGAEGAAAQTEKGKRRLLTTVAIAAELRASSGRYYSV 37 + G + A A A+AQT +G+R L + ++A ASS R YSV Sbjct: 584 EHGESADFAAAAVRASAQTARGER*TLQSTCLSAPSMASSSRPYSV 447
>LOC_Os03g61249:12003.t05358:unspliced-genomic no apical meristem protein| Length = 951 Score = 34.5 bits (69), Expect = 0.76 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = -3 / -2 Query: 174 DSGSATRDAMGAEGAAAQTEKGKRRLLTTVAIAAELRASSGRYYSV 37 + G + A A A+AQT +G+R L + ++A ASS R YSV Sbjct: 584 EHGESADFAAAAVRASAQTARGER*TLQSTCLSAPSMASSSRPYSV 447
>LOC_Os07g34240:12007.t03101:unspliced-genomic gibberellin receptor GID1L2, putative| Length = 1320 Score = 34.1 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +1 / +3 Query: 403 RRRPDRGGVGAHLRRVPHLGPRHRDTQ 483 RRR D GGVG RVP L P RD Q Sbjct: 867 RRRRDGGGVGGRGPRVPPLQPSPRDQQ 947
>LOC_Os06g34830:12006.t03180:unspliced-genomic cationic amino acid transporter 4, putative, expressed| Length = 2491 Score = 34.1 bits (68), Expect = 1.0 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +1 / +3 Query: 388 RPELPRRRPDRGGVGAHLRRVP 453 RP LPRR D G AHL RVP Sbjct: 1674 RPPLPRRGGDDAGAAAHLPRVP 1739
>LOC_Os01g50330:12001.t04467:unspliced-genomic strictosidine synthase 1 precursor, putative, expressed| Length = 1020 Score = 34.1 bits (68), Expect = 1.0 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 / +3 Query: 157 RRAPAVVDGCQGHEAPRAGDVQGEA 231 RR VDGCQG A R G +G+A Sbjct: 900 RRGGGGVDGCQGRHAQRGGGAEGQA 974
>LOC_Os01g50450:12001.t04480:unspliced-genomic expressed protein| Length = 3842 Score = 27.2 bits (53), Expect(2) = 1.1 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 / +1 Query: 134 PSAPMASRVALPLSSTAAR 190 P P+A+RVA P SS A R Sbjct: 430 PPLPLAARVAFPCSSLALR 486 Score = 24.0 bits (46), Expect(2) = 1.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 / +3 Query: 169 AVVDGCQGHEAPRAGDVQGEAD 234 AVV GC G E G+++G+ D Sbjct: 588 AVVCGCSGCE*GLHGELRGDGD 653
>LOC_Os07g33120:12007.t02992:unspliced-genomic expressed protein| Length = 3210 Score = 32.2 bits (64), Expect(2) = 1.2 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 / -3 Query: 116 SVCAAAPSAPMASRVALPLSSTAARGMRLRAQATY 220 S+C +APSA A+ +L + T A GM +A+Y Sbjct: 2257 SICRSAPSAEAAATASLMRAKTRAAGMDAADRASY 2153 Score = 23.1 bits (44), Expect(2) = 1.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 / -1 Query: 418 RGGVGAHLRRVPHLGPRHRD 477 R G G HL R+ H P +RD Sbjct: 1893 RPGRGCHLARM*HHVPCYRD 1834
>LOC_Os07g16550:12007.t01515:unspliced-genomic transposon protein, putative, unclassified| Length = 1042 Score = 31.3 bits (62), Expect(2) = 1.4 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731 Score = 22.1 bits (42), Expect(2) = 1.4 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 732 FPVCLCVC 755
>LOC_Os01g25320:12001.t02249:unspliced-genomic auxilin-like protein, putative, expressed| Length = 11152 Score = 28.6 bits (56), Expect(2) = 1.4 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +2 / -1 Query: 59 LARSSAAMATVVSSLRLPFSVCAAAPSAPMASRVALPLSSTAARGMRLRAQA 214 LAR+SAA ++ S + AA + +AS L +S AA RA A Sbjct: 3616 LARASAAAFSLASVAARSLASAAALAALSLASSATLSFASAAAFAALSRASA 3461 Score = 28.1 bits (55), Expect(2) = 1.4 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 / -1 Query: 403 RRRPDRGGVGAHLRRVPHLGPRHRDTQGGG 492 RRR RGG LRR +G H GGG Sbjct: 331 RRRGGRGGRLGGLRRAVEVGVEHVVVVGGG 242
>LOC_Os10g11420:12010.t00940:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1741 Score = 33.6 bits (67), Expect = 1.4 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPMASRVAL 166 RSS M VSS LP S C PS P+ R++L Sbjct: 725 RSSLKMKASVSSSCLPSSACGLRPSLPLLLRLSL 826
>LOC_Os03g12470:12003.t01046:unspliced-genomic OsWAK25 - OsWAK receptor-like protein kinase, expressed| Length = 4367 Score = 30.9 bits (61), Expect(2) = 1.5 Identities = 13/39 (33%), Positives = 25/39 (64%) Frame = +2 / -3 Query: 71 SAAMATVVSSLRLPFSVCAAAPSAPMASRVALPLSSTAA 187 +A+ AT+ +R+ S+C + + M+SR+ P+ STA+ Sbjct: 3894 NASSATLWMDVRVQASLCGSR*GSTMSSRLPFPILSTAS 3778 Score = 24.4 bits (47), Expect(2) = 1.5 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 / -2 Query: 598 VISTCCCGRNLIA 636 V STC C RN+IA Sbjct: 1282 VDSTCSCARNVIA 1244
>LOC_Os06g32040:12006.t02902:unspliced-genomic transposon protein, putative, unclassified| Length = 1273 Score = 31.3 bits (62), Expect(2) = 1.7 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 304 RSSLKMKALVSSSCLPSSACGRRPSLPL 221 Score = 22.1 bits (42), Expect(2) = 1.7 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -1 Query: 534 FPACACIC 557 FP C C+C Sbjct: 220 FPVCLCVC 197
>LOC_Os07g27550:12007.t02449:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1888 Score = 31.8 bits (63), Expect(2) = 1.8 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RS M +VSS RLP S C PS P+ Sbjct: 644 RSPWMMKALVSSSRLPSSACGRRPSLPL 727 Score = 22.1 bits (42), Expect(2) = 1.8 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +2 Query: 534 FPACACIC 557 FP C C+C Sbjct: 728 FPVCLCVC 751
>LOC_Os02g24220:12002.t02119:unspliced-genomic transposon protein, putative, unclassified| Length = 1381 Score = 31.3 bits (62), Expect(2) = 1.8 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RS M +VSS RLP S C PS P+ Sbjct: 730 RSPWKMKALVSSSRLPSSACGRHPSLPL 813 Score = 22.1 bits (42), Expect(2) = 1.8 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +1 Query: 534 FPACACIC 557 FP C C+C Sbjct: 814 FPVCLCVC 837
>LOC_Os12g25310:12012.t02253:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1393 Score = 31.8 bits (63), Expect(2) = 1.8 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RS M +VSS RLP S C PS P+ Sbjct: 649 RSPWKMKALVSSSRLPSSACGRRPSLPL 732 Score = 21.7 bits (41), Expect(2) = 1.8 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +1 Query: 534 FPACACIC 557 FP C C+C Sbjct: 733 FPICLCVC 756
>LOC_Os12g23520:12012.t02082:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass, expressed| Length = 15208 Score = 31.3 bits (62), Expect(2) = 1.8 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 14228 RSSLKMKALVSSSCLPSSACGRRPSLPL 14145 Score = 25.4 bits (49), Expect(2) = 1.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 / -2 Query: 541 RARVYARCMNCIRILRSYRVISTCCCGR 624 RAR A C R L S+ S CC R Sbjct: 10422 RARRLASKARCRRSLASFAARSRSCCSR 10339
>LOC_Os04g16490:12004.t01408:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1418 Score = 31.3 bits (62), Expect(2) = 1.9 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 171 RSSWKMKALVSSSCLPLSTCGRRPSLPL 254 Score = 22.1 bits (42), Expect(2) = 1.9 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 255 FPVCLCVC 278
>LOC_Os01g59440:12001.t05333:unspliced-genomic BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1| precursor, putative, expressed Length = 3989 Score = 27.6 bits (54), Expect(2) = 2.0 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 / +3 Query: 397 LPRRRPDRGGVGA 435 LPR RPD GG+GA Sbjct: 102 LPRARPDPGGMGA 140 Score = 22.6 bits (43), Expect(2) = 2.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 / +2 Query: 427 VGAHLRRVPHLGPRH 471 +G H R+ HL PRH Sbjct: 269 LGPHARQPLHLVPRH 313
>LOC_Os08g07200:12008.t00609:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative| Length = 2160 Score = 33.1 bits (66), Expect = 2.0 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 / -3 Query: 178 DGCQGHEAPRAGDVQG 225 DGC G E+PRAG+V G Sbjct: 484 DGCSGSESPRAGEVDG 437
>LOC_Os07g34520:12007.t03128:unspliced-genomic isocitrate lyase, putative, expressed| Length = 2641 Score = 33.1 bits (66), Expect = 2.0 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +1 / +2 Query: 397 LPRRRPDRGGVGAHLRRVPHLGPRHRDTQGGGAHR 501 +PRRR G V LR H G R D +GG R Sbjct: 1754 VPRRRARHGHVRPRLRAARHAGVRGEDPEGGEEQR 1858
>LOC_Os07g16910:12007.t01551:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6649 Score = 33.1 bits (66), Expect = 2.0 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP SVC PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSVCGRRPSLPL 732
>LOC_Os06g26234:12006.t02428:unspliced-genomic 1,4-alpha-glucan branching enzyme, putative, expressed| Length = 29845 Score = 33.1 bits (66), Expect = 2.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 / +3 Query: 606 YLLLWSEFDCLLMPVLIFP 662 YLL W F+CL++P L FP Sbjct: 3474 YLLFWVSFNCLILPKLGFP 3530
>LOC_Os05g38910:12005.t03433:unspliced-genomic conserved hypothetical protein| Length = 528 Score = 33.1 bits (66), Expect = 2.0 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 / -1 Query: 391 PELPRRRPDRGGVGAHLRRVPHLGPRHRD 477 P+LPRRR D H R P PRHRD Sbjct: 231 PDLPRRRRDPRRRQLHRRPPPPRPPRHRD 145
>LOC_Os04g06429:12004.t00527:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1985 Score = 33.1 bits (66), Expect = 2.0 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPMASRVAL 166 RSS M VSS LP S C PS P+ R++L Sbjct: 661 RSSLKMKVWVSSSCLPSSACGRRPSLPLLLRLSL 762
>LOC_Os02g46740:12002.t04261:unspliced-genomic RWD domain containing protein, expressed| Length = 3164 Score = 33.1 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 / -3 Query: 139 GAHGIPRRAPAVVDGCQGHEAPRA 210 G G+P AP DG +G EAPRA Sbjct: 2031 GDAGVPDVAPLPADGAEGEEAPRA 1960
>LOC_Os01g29150:12001.t02605:unspliced-genomic cytochrome P450 72A1, putative, expressed| Length = 2885 Score = 33.1 bits (66), Expect = 2.0 Identities = 19/61 (31%), Positives = 24/61 (39%) Frame = +1 / -2 Query: 1 DTILSCLVELSVHGVVPSRASSQLRRNGHRGEQXXXXXXXXXXXXXGAHGIPRRAPAVVD 180 D + S L+ L VHG ++RR GE+ GAH R PAV Sbjct: 1900 DLLASALLPLRVHGEYDDGPCQEVRRRLFAGEEECLALLDDVVYCDGAHR*RRSLPAVAA 1721 Query: 181 G 183 G Sbjct: 1720 G 1718
>LOC_Os01g14440:12001.t01302:unspliced-genomic OsWRKY1v2 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 2673 Score = 33.1 bits (66), Expect = 2.0 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 / -3 Query: 403 RRRPDRGGVGAHLRRVPHLGPRHRDTQGGG 492 RRR GVG R++P PR R+ +GGG Sbjct: 2125 RRRRRADGVGERARQLPDRRPRLRELRGGG 2036
>LOC_Os05g20190:12005.t01780:unspliced-genomic hypothetical protein| Length = 1683 Score = 31.3 bits (62), Expect(2) = 2.2 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 791 RSSLKMKALVSSSCLPSSACGRRPSLPL 708 Score = 22.1 bits (42), Expect(2) = 2.2 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -2 Query: 534 FPACACIC 557 FP C C+C Sbjct: 707 FPVCLCVC 684
>LOC_Os03g37670:12003.t03219:unspliced-genomic DNA binding protein, putative| Length = 3551 Score = 27.2 bits (53), Expect(2) = 2.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 / -1 Query: 157 RRAPAVVDGCQGHEAPRAGD 216 RRA A+ GC+G PR GD Sbjct: 2864 RRALALGGGCRGTPQPREGD 2805 Score = 27.2 bits (53), Expect(2) = 2.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 / -2 Query: 412 PDRGGVGAHLRRVPHLGPRHRDTQ 483 PDR G G+HL + G R RD + Sbjct: 2053 PDRWGHGSHLSAMGERGGRWRDAE 1982
>LOC_Os04g48680:12004.t04384:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1953 Score = 31.3 bits (62), Expect(2) = 2.5 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RS M +VSS RLP S C PS P+ Sbjct: 706 RSPWMMKALVSSSRLPSSACGHRPSLPL 789 Score = 22.1 bits (42), Expect(2) = 2.5 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +1 Query: 534 FPACACIC 557 FP C C+C Sbjct: 790 FPVCLCVC 813
>LOC_Os05g20170:12005.t01778:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1978 Score = 31.3 bits (62), Expect(2) = 2.5 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 724 RSSLKMKALVSSSCLPSSACGRRPSLPL 807 Score = 22.1 bits (42), Expect(2) = 2.5 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +1 Query: 534 FPACACIC 557 FP C C+C Sbjct: 808 FPVCLCVC 831
>LOC_Os10g16920:12010.t01254:unspliced-genomic transposon protein, putative, unclassified| Length = 2166 Score = 31.3 bits (62), Expect(2) = 2.7 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 1197 RSSLKMKALVSSSCLPSSACGRRPSLPL 1114 Score = 22.1 bits (42), Expect(2) = 2.7 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -1 Query: 534 FPACACIC 557 FP C C+C Sbjct: 1113 FPVCLCVC 1090
>LOC_Os12g07290:12012.t00613:unspliced-genomic alpha-(1,4)-fucosyltransferase, putative, expressed| Length = 3959 Score = 32.7 bits (65), Expect = 2.7 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 / -3 Query: 406 RRPDRGGVGAHLRRVPHLGPRHRDTQGGGAHR 501 RR RGGVG R + G + GGG HR Sbjct: 285 RRRRRGGVGGDGRELEVAGDEEEEDDGGGQHR 190
>LOC_Os11g05370:12011.t00429:unspliced-genomic 60S ribosomal protein L26-1, putative, expressed| Length = 1036 Score = 32.7 bits (65), Expect = 2.7 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +2 / -3 Query: 107 LPFSVCAAAPSAPMASRVALPLSSTAARGMRLRAQ 211 + +S AAP+A +S V LPL+ +AAR + LR++ Sbjct: 485 ISWSEAPAAPAAATSSAVNLPLALSAARPLALRSR 381
>LOC_Os10g31810:12010.t02504:unspliced-genomic expressed protein| Length = 2364 Score = 32.7 bits (65), Expect = 2.7 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -2 / +1 Query: 244 LRRDQLHLVRRLRAEPHAPGSRRRQRER 161 LR QLHL RR PH G RRR R + Sbjct: 397 LRHLQLHLPRRRLRPPHRRGLRRRHRRQ 480
>LOC_Os10g27110:12010.t02118:unspliced-genomic expressed protein| Length = 2137 Score = 32.7 bits (65), Expect = 2.7 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 / +3 Query: 397 LPRRRPDRGGVGAHLRRVPHLGPRHR 474 LPRRR RGG HLRR P R R Sbjct: 1560 LPRRRRRRGGARGHLRRPPRPLRRRR 1637
>LOC_Os08g22570:12008.t02033:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1780 Score = 32.7 bits (65), Expect = 2.7 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 / +2 Query: 47 YLPELARSSAAMATVVSSLRLPFSVCAAAPSAPMAS 154 + P RS+ M +VSS LP S C PS P+ S Sbjct: 683 FFPTQKRSTWRMKALVSSSCLPSSACGRRPSLPLFS 790
>LOC_Os07g36560:12007.t03326:unspliced-genomic 10-deacetylbaccatin III 10-O-acetyltransferase, putative, expressed| Length = 2168 Score = 32.7 bits (65), Expect = 2.7 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 / +2 Query: 391 PELPRRRPDRGGVGAHLRRVPHLGPRHRDTQGGG 492 P RRRP RGG RR L PR R Q GG Sbjct: 233 PRRRRRRPRRGGQERARRRARALLPRRRKDQ*GG 334
>LOC_Os07g29410:12007.t02631:unspliced-genomic electron transporter/ thiol-disulfide exchange intermediate,| putative, expressed Length = 1444 Score = 32.7 bits (65), Expect = 2.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 / +1 Query: 442 RRVPHLGPRHRDTQGGGAHR 501 RRVPHL P R Q GGA R Sbjct: 808 RRVPHLRPPRRGRQAGGARR 867
>LOC_Os04g56560:12004.t05126:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 2696 Score = 32.7 bits (65), Expect = 2.7 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 / +2 Query: 400 PRRRPDRGGVGAHLRRVPHLGPRHRDTQGGGAHRL 504 PR R G G HLRRVP R G G H L Sbjct: 1448 PRLRHPHGARGRHLRRVPRRHAAVRPRAGRGQHLL 1552
>LOC_Os01g40530:12001.t03577:unspliced-genomic hypothetical protein| Length = 1363 Score = 32.7 bits (65), Expect = 2.7 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 / +1 Query: 403 RRRPDRGGVGAHLRRVPHLGPRHRDTQGGGAHR 501 RRRP R GV RR PRHR Q G R Sbjct: 886 RRRPARAGVARRRRRRLRRPPRHRRVQQG*GRR 984
>LOC_Os10g14060:12010.t01128:unspliced-genomic hypothetical protein| Length = 1193 Score = 30.4 bits (60), Expect(2) = 2.9 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 704 RSSWKMKALVSSSCLPSSACGRRPSLPL 787 Score = 22.1 bits (42), Expect(2) = 2.9 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +2 Query: 534 FPACACIC 557 FP C C+C Sbjct: 788 FPVCLCVC 811
>LOC_Os05g25480:12005.t02204:unspliced-genomic hydrolase, hydrolyzing O-glycosyl compounds, putative, expressed| Length = 2319 Score = 30.4 bits (60), Expect(2) = 2.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 / +2 Query: 409 RPDRGGVGAHLRRVPHLGPRHRDTQG 486 RPD GVGAH R L P R G Sbjct: 1472 RPDHHGVGAHERAALRLRPHRRHAPG 1549 Score = 23.1 bits (44), Expect(2) = 2.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 / +3 Query: 472 RDTQGGGAHR 501 RD GGGAHR Sbjct: 1884 RDVVGGGAHR 1913
>LOC_Os03g31150:12003.t02714:unspliced-genomic expressed protein| Length = 3512 Score = 29.0 bits (57), Expect(2) = 3.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 / +1 Query: 427 VGAHLRRVPHLGPRHRDTQGGGAH 498 V AH + H P HR GGG H Sbjct: 862 VPAHAAQHRHRAPPHRQEHGGGVH 933 Score = 24.9 bits (48), Expect(2) = 3.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 / +2 Query: 53 PELARSSAAMATVVSSLRLPFSVCAAAPSAP 145 P AR ++A S RLP + AAA P Sbjct: 146 PLAARGGVSIAIAFSVSRLPSAAAAAAAGKP 238
>LOC_Os06g31440:12006.t02845:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2535 Score = 31.3 bits (62), Expect(2) = 3.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731 Score = 22.1 bits (42), Expect(2) = 3.1 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 732 FPVCLCVC 755
>LOC_Os10g37110:12010.t02983:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 1908 Score = 31.3 bits (62), Expect(2) = 3.3 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 / +3 Query: 412 PDRGGVGAHLRRVPHLGPRHRDTQGGG 492 P +GG G RRVPH H + GGG Sbjct: 1206 PSQGGGGHGDRRVPHPQGHHGELHGGG 1286 Score = 21.7 bits (41), Expect(2) = 3.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 / +2 Query: 131 APSAPMASRVALPLSSTAARGMRLRA 208 APS+P ASR SS A R+ Sbjct: 242 APSSPSASRPGCSSSSPTAASRTRRS 319
>LOC_Os01g56380:12001.t05047:unspliced-genomic tyrosine/DOPA decarboxylase 2, putative, expressed| Length = 1943 Score = 30.9 bits (61), Expect(2) = 3.3 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 / +3 Query: 394 ELPRRRPDRGGVGAHLRRVPHLG 462 E RRRP RG G H RR H+G Sbjct: 492 EQHRRRPRRGARGRHQRRAFHVG 560 Score = 22.1 bits (42), Expect(2) = 3.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 / +2 Query: 37 HGVVPSRASSQLRRNGHR 90 HG+VPSR + RR R Sbjct: 167 HGMVPSRRWRRRRRRRRR 220
>LOC_Os04g38129:12004.t03384:unspliced-genomic transposon protein, putative, unclassified| Length = 2755 Score = 31.3 bits (62), Expect(2) = 3.3 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731 Score = 22.1 bits (42), Expect(2) = 3.3 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 732 FPVCLCVC 755
>LOC_Os08g39770:12008.t03708:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1980 Score = 30.9 bits (61), Expect(2) = 3.4 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 / +3 Query: 68 SSAAMATVVSSLRLPFSVCAAAPSAPM 148 SS M +VSSL LP S C PS P+ Sbjct: 732 SSWKMKALVSSLCLPSSACGRRPSLPL 812 Score = 22.1 bits (42), Expect(2) = 3.4 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 813 FPVCLCVC 836
>LOC_Os08g11940:12008.t01074:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2831 Score = 31.3 bits (62), Expect(2) = 3.4 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 1925 RSSLKMKALVSSSCLPSSACGRRPSLPL 1842 Score = 22.1 bits (42), Expect(2) = 3.4 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -1 Query: 534 FPACACIC 557 FP C C+C Sbjct: 1841 FPVCLCVC 1818
>LOC_Os01g36180:12001.t03168:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2860 Score = 29.9 bits (59), Expect(2) = 3.5 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M VSS LP S C PS P+ Sbjct: 1918 RSSLKMKASVSSSCLPSSACGLRPSLPL 1835 Score = 23.5 bits (45), Expect(2) = 3.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 / -3 Query: 541 RARVYARCMNCIRILRSYRVISTCCCGR 624 RAR A C R S+ V S CC R Sbjct: 791 RARRPASKARCRRSSASFAVRSRSCCSR 708
>LOC_Os01g34610:12001.t03018:unspliced-genomic expressed protein| Length = 4238 Score = 26.3 bits (51), Expect(2) = 3.5 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 / +2 Query: 531 PFPACACICTMHELY 575 PFP+C+C C + ++ Sbjct: 344 PFPSCSCYCILLSIF 388 Score = 23.1 bits (44), Expect(2) = 3.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 / +3 Query: 627 FDCLLMPVLIFPKKKKK 677 F +++ +L FPK KKK Sbjct: 420 FSVMMLAMLQFPKTKKK 470
>LOC_Os11g43540:12011.t03884:unspliced-genomic hypothetical protein| Length = 1226 Score = 32.2 bits (64), Expect = 3.7 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 / -3 Query: 388 RPELPRRRPDRGGVGAHLRRVPHLGPRHR 474 RP RRRP +H +PH PRHR Sbjct: 90 RPPPQRRRPSSSPHPSHTSSLPHCCPRHR 4
>LOC_Os11g12210:12011.t01108:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6755 Score = 32.2 bits (64), Expect = 3.7 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS+ M +VSS LP S C PS P+ Sbjct: 730 RSSSKMKALVSSSCLPSSACGRRPSLPL 813
>LOC_Os11g12200:12011.t01107:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6703 Score = 32.2 bits (64), Expect = 3.7 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS+ M +VSS LP S C PS P+ Sbjct: 5797 RSSSKMKALVSSSCLPSSACGRRPSLPL 5714
>LOC_Os10g37100:12010.t02982:unspliced-genomic cytochrome P450 89A2, putative| Length = 1539 Score = 32.2 bits (64), Expect = 3.7 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 / +3 Query: 391 PELPRRRPDRGGVGAHLRRVPHLGPRHRDTQGG 489 P P R +GG G RRVPH RH + GG Sbjct: 1122 PAGPLRAAAQGGGGHGRRRVPHPQGRHGELHGG 1220
>LOC_Os09g15660:12009.t01354:unspliced-genomic hypothetical protein| Length = 1308 Score = 32.2 bits (64), Expect = 3.7 Identities = 23/56 (41%), Positives = 27/56 (48%) Frame = +2 / +2 Query: 50 LPELARSSAAMATVVSSLRLPFSVCAAAPSAPMASRVALPLSSTAARGMRLRAQAT 217 L A SSA+ SS R P + AA SAP A+ A+ SSTAA A T Sbjct: 68 LSSRASSSASRRRTGSSARPPPASGGAASSAPAAAPPAVRSSSTAAAATPSSATTT 235
>LOC_Os09g10780:12009.t03506:unspliced-genomic expressed protein| Length = 637 Score = 32.2 bits (64), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +1 / +2 Query: 430 GAHLRRVPHLGPRHRDTQGGG 492 GA R P LGPRHR GGG Sbjct: 296 GARGRSAPPLGPRHRRVVGGG 358
>LOC_Os08g05340:12008.t00428:unspliced-genomic expressed protein| Length = 4754 Score = 32.2 bits (64), Expect = 3.7 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 / -1 Query: 478 TQGGGAHRLNSLILCISIRFRRARVYARCMNCIRI 582 T GGG HR L+ + RRAR Y R + IRI Sbjct: 398 TAGGGGHRRCRLLPLLRRLIRRARHYPRVVGRIRI 294
>LOC_Os07g24520:12007.t02149:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6642 Score = 32.2 bits (64), Expect = 3.7 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP SVC PS P+ Sbjct: 648 RSSWRMKALVSSSCLPSSVCGRRPSLPL 731
>LOC_Os07g24440:12007.t02141:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6642 Score = 32.2 bits (64), Expect = 3.7 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP SVC PS P+ Sbjct: 648 RSSWRMKALVSSSCLPSSVCGRRPSLPL 731
>LOC_Os03g59690:12003.t05214:unspliced-genomic plant-specific domain TIGR01570 family protein| Length = 951 Score = 32.2 bits (64), Expect = 3.7 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -3 / -2 Query: 636 SNQIPTTAASTNYSVTPQYPDTVHASCIYTRTP 538 S P +AST+ TP DTV +SCI R+P Sbjct: 803 SPSAPAGSASTSPGSTPAPTDTVLSSCITARSP 705
>LOC_Os03g47670:12003.t04129:unspliced-genomic ankyrin-like protein, putative| Length = 5231 Score = 32.2 bits (64), Expect = 3.7 Identities = 10/27 (37%), Positives = 20/27 (74%) Frame = +1 / -1 Query: 505 NSLILCISIRFRRARVYARCMNCIRIL 585 N + LCIS+ +++R+Y +NC+R++ Sbjct: 863 NHIFLCISMCLQQSRMYLLKLNCLRLI 783
>LOC_Os03g41110:12003.t03528:unspliced-genomic zinc finger protein 1, putative, expressed| Length = 1294 Score = 32.2 bits (64), Expect = 3.7 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 / -1 Query: 214 RLRAEPHAPGSRRRQR 167 RLR+EP APG RRR+R Sbjct: 934 RLRSEPEAPGPRRRRR 887
>LOC_Os01g56840:12001.t05094:unspliced-genomic expressed protein| Length = 972 Score = 32.2 bits (64), Expect = 3.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 / -1 Query: 406 RRPDRGGVGAHLRRVPHLGPRHRDTQGGGAHRLNSLI 516 R+P G V LRR H PR R +GGG R + + Sbjct: 666 RQPRVGAVVELLRRRQHRPPRPRPVRGGGGERRHGAV 556
>LOC_Os04g16520:12004.t01411:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1608 Score = 30.4 bits (60), Expect(2) = 3.8 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSWKMKALVSSSCLPSSACGRRPSLPL 732 Score = 22.1 bits (42), Expect(2) = 3.8 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +1 Query: 534 FPACACIC 557 FP C C+C Sbjct: 733 FPVCLCVC 756
>LOC_Os03g23870:12003.t02082:unspliced-genomic transposon protein, putative, unclassified| Length = 3192 Score = 31.3 bits (62), Expect(2) = 3.8 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 3113 RSSLKMKALVSSSCLPSSACGRRPSLPL 3030 Score = 22.1 bits (42), Expect(2) = 3.8 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -1 Query: 534 FPACACIC 557 FP C C+C Sbjct: 2175 FPVCLCVC 2152
>LOC_Os09g09760:12009.t00768:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6955 Score = 31.3 bits (62), Expect(2) = 4.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 6013 RSSMKMKALVSSSCLPSSACGRRPSLPL 5930 Score = 23.1 bits (44), Expect(2) = 4.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 / -2 Query: 424 GVGAHLRRVPHLGPRHRDTQGGGAHRLNS 510 GV R H GPR GG HRL S Sbjct: 3378 GVRGR*VRPSHSGPRAILGVGGTRHRLTS 3292
>LOC_Os06g20130:12006.t01830:unspliced-genomic conserved hypothetical protein| Length = 3532 Score = 29.0 bits (57), Expect(2) = 4.1 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 / -2 Query: 101 LRLPFSVCAAAPSAP 145 LRLP + CAAAP AP Sbjct: 3147 LRLPTAACAAAPRAP 3103 Score = 24.4 bits (47), Expect(2) = 4.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 / -2 Query: 385 VRPELPRRRPDRGGVGAH 438 V P RR P RGG G H Sbjct: 1572 VAPGRERRGPGRGGEGRH 1519
>LOC_Os10g06460:12010.t00515:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2516 Score = 30.9 bits (61), Expect(2) = 4.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 1611 RSSLKMKALVSSSCLPSSACGRHPSLPL 1528 Score = 22.1 bits (42), Expect(2) = 4.1 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 1527 FPVCLCVC 1504
>LOC_Os03g45680:12003.t03940:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1799 Score = 30.4 bits (60), Expect(2) = 4.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 546 RSSWKMKALVSSSCLPSSACGRRPSLPL 629 Score = 22.1 bits (42), Expect(2) = 4.1 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 630 FPVCLCVC 653
>LOC_Os08g20840:12008.t01893:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1800 Score = 27.2 bits (53), Expect(2) = 4.2 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAP 145 RS M +VSS LP S C PS P Sbjct: 649 RSPWKMKALVSSSCLPSSACGRRPSLP 729 Score = 25.4 bits (49), Expect(2) = 4.2 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 / +1 Query: 531 PFPACACIC 557 PFP C C+C Sbjct: 730 PFPVCLCVC 756
>LOC_Os04g24980:12004.t02207:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1903 Score = 30.4 bits (60), Expect(2) = 4.4 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 647 RSSWRMKALVSSSCLPSSACGRRPSLPL 730 Score = 22.1 bits (42), Expect(2) = 4.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 439 LRRVPHLGPRHRDTQGGGAHR 501 LRR P R R + GGG+ R Sbjct: 1780 LRRDPSCRARARGSSGGGSLR 1842
>LOC_Os10g37630:12010.t03023:unspliced-genomic fas-associated factor 1-like protein, putative, expressed| Length = 4352 Score = 24.9 bits (48), Expect(2) = 4.7 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 / -2 Query: 385 VRPELPRRRPDRGGVGAHLRRVPH 456 +RP R R RG AHLRR H Sbjct: 601 LRPRPARGRGWRGSETAHLRRPRH 530 Score = 24.0 bits (46), Expect(2) = 4.7 Identities = 6/11 (54%), Positives = 6/11 (54%) Frame = +3 / -1 Query: 525 FHPFPACACIC 557 FH P C C C Sbjct: 461 FHAIPGCCCCC 429
>LOC_Os09g17390:12009.t01525:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4334 Score = 31.3 bits (62), Expect(2) = 4.9 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731 Score = 22.1 bits (42), Expect(2) = 4.9 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 732 FPVCLCVC 755
>LOC_Os10g20030:12010.t01500:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4497 Score = 31.3 bits (62), Expect(2) = 5.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 726 RSSLKMKALVSSSCLPSSACGRRPSLPL 809 Score = 22.1 bits (42), Expect(2) = 5.1 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 810 FPVCLCVC 833
>LOC_Os11g37210:12011.t03263:unspliced-genomic expressed protein| Length = 1067 Score = 31.8 bits (63), Expect = 5.1 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +1 / -1 Query: 403 RRRPDRGGVGAHLRRVPHLGPRHR 474 RRRP RGG GA RR P G R R Sbjct: 875 RRRPARGGGGAARRRRPAEGRRRR 804
>LOC_Os10g26620:12010.t02073:unspliced-genomic expressed protein| Length = 2893 Score = 31.8 bits (63), Expect = 5.1 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 / +2 Query: 68 SSAAMATVVSSLRLPFSVCAAAPSAPMASRVALP 169 S A A+ S+ P + CA +PSAP A+R P Sbjct: 1376 SLATSASTASATGPPAAPCATSPSAPAAARTRTP 1477
>LOC_Os10g24570:12010.t01882:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3033 Score = 31.8 bits (63), Expect = 5.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSCKMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os10g11666:12010.t00962:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1903 Score = 31.8 bits (63), Expect = 5.1 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C+ PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACSRRPSLPL 731
>LOC_Os10g04450:12010.t00329:unspliced-genomic expressed protein| Length = 1535 Score = 31.8 bits (63), Expect = 5.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 / +1 Query: 53 EGTTPWTDSSTRHERI 6 EGTT WT SST H+R+ Sbjct: 322 EGTTCWTQSSTNHQRM 369
>LOC_Os09g36800:12009.t03156:unspliced-genomic 3-dehydroquinate synthase, putative, expressed| Length = 3378 Score = 31.8 bits (63), Expect = 5.1 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = +2 / +2 Query: 62 ARSSAAMATVVSSLRLPFSVCAAAPSAPMASRVALPLSSTAARGMRLRAQA 214 A SS+ +A SS R APSA A+ +LP S A+ LRA A Sbjct: 59 AASSSLLAAASSSSRAAAVSARRAPSASPAAAASLPSPSRASCAPPLRASA 211
>LOC_Os09g15870:12009.t01375:unspliced-genomic hypothetical protein| Length = 300 Score = 31.8 bits (63), Expect = 5.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 / -1 Query: 388 RPELPRRRPDRGGVGAHLRRVP 453 RP P RP+R G G+ LRR+P Sbjct: 192 RPLRPHHRPERRGCGSPLRRLP 127
>LOC_Os09g14350:12009.t01224:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2550 Score = 31.8 bits (63), Expect = 5.1 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 / -2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPMA 151 RSS M +VSS LP S C PS P++ Sbjct: 1652 RSSLKMKALVSSSCLPSSACGRRPSLPLS 1566
>LOC_Os09g11020:12009.t00892:unspliced-genomic NBS-LRR disease resistance protein, putative| Length = 6679 Score = 31.8 bits (63), Expect = 5.1 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -3 / +3 Query: 186 AAVDDSGSATRDAMGAEGAAAQTEKGKRRLLTTVAIAAELRASSGRYYSV 37 +AV AMG+ AA + G TT+ +A + SGR++ V Sbjct: 81 SAVGTGKGGAYPAMGSSAAAVKVAWGSTTASTTITVACGWKGGSGRWWVV 230
>LOC_Os09g01270:12009.t00029:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6672 Score = 31.8 bits (63), Expect = 5.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGCRPSLPL 731
>LOC_Os07g13090:12007.t01179:unspliced-genomic hypothetical protein| Length = 1239 Score = 31.8 bits (63), Expect = 5.1 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 / +2 Query: 110 PFSVCAAAPSAPMASRVALPLSSTAARG 193 P C+AA AP +RV P +S AARG Sbjct: 890 PCGSCSAACPAPWTTRVPSPTASRAARG 973
>LOC_Os07g03580:12007.t00248:unspliced-genomic pathogenesis-related protein PRB1-2 precursor, putative, expressed| Length = 724 Score = 31.8 bits (63), Expect = 5.1 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 / +1 Query: 403 RRRPDRGGVGAHLRRVPHLGPRHRDTQGGG 492 RR VG LRR P LGPR GGG Sbjct: 283 RRVRSPAHVGQRLRREPLLGPRREGVVGGG 372
>LOC_Os05g35230:12005.t03116:unspliced-genomic expressed protein| Length = 2911 Score = 31.8 bits (63), Expect = 5.1 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 / +1 Query: 174 DSGSATRDAMGAEGAAAQTEKGKRRL 97 D+G+A D GA GAAA +G+R L Sbjct: 2794 DAGAAVSDVPGAAGAAAPVAEGRRAL 2871
>LOC_Os05g17550:12005.t01524:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1880 Score = 31.8 bits (63), Expect = 5.1 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP SVC PS P+ Sbjct: 319 RSSWKMKALVSSSCLPSSVCGRHPSLPL 402
>LOC_Os05g17010:12005.t01470:unspliced-genomic terpene synthase 7, putative| Length = 5736 Score = 31.8 bits (63), Expect = 5.1 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPMA 151 RSS M +VSS LP S C PS P++ Sbjct: 724 RSSLKMKALVSSSCLPSSACGRRPSLPLS 810
>LOC_Os05g17000:12005.t01469:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6724 Score = 31.8 bits (63), Expect = 5.1 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPMA 151 RSS M +VSS LP S C PS P++ Sbjct: 724 RSSLKMKALVSSSCLPSSACGRRPSLPLS 810
>LOC_Os04g59360:12004.t05393:unspliced-genomic csAtPR5, putative| Length = 2971 Score = 31.8 bits (63), Expect = 5.1 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 / +2 Query: 454 HLGPRHRDTQGGGAHRLNSLILCISIRFRRARVYARCMNC 573 H+G R RD GG A +L +RFR + C C Sbjct: 2783 HVGKRTRDDDGGIAQNDEALFTTDKVRFRPKKSGESCATC 2902
>LOC_Os04g12070:12004.t01031:unspliced-genomic hypothetical protein| Length = 348 Score = 31.8 bits (63), Expect = 5.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / -3 Query: 250 LALRRDQLHLVRRLRAEPHAPGSRR 176 L +RR + HL+R +R PH P RR Sbjct: 91 LLVRRRRFHLLRGVRPRPHLPRGRR 17
>LOC_Os04g05160:12004.t00398:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6727 Score = 31.8 bits (63), Expect = 5.1 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPMASRVALPLSSTAAR 190 RSS M +VSS LP S C PS P+ V + AR Sbjct: 725 RSSLKMKALVSSSCLPSSACGRRPSLPLFFFVVFVCWAVVAR 850
>LOC_Os03g51650:12003.t04491:unspliced-genomic expressed protein| Length = 5305 Score = 31.8 bits (63), Expect = 5.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 / +3 Query: 409 RPDRGGVGAHLRRVPHLGPRHR 474 R G G H RRVP LG RHR Sbjct: 432 RVQLAGGGGHRRRVPRLGVRHR 497
>LOC_Os03g23760:12003.t02071:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass, expressed| Length = 8877 Score = 31.8 bits (63), Expect = 5.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 727 RSSGKMKALVSSSCLPSSACGRRPSLPL 810
>LOC_Os03g11700:12003.t00971:unspliced-genomic tetratricopeptide-like helical, putative, expressed| Length = 1342 Score = 31.8 bits (63), Expect = 5.1 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +1 / +2 Query: 403 RRRPDRGGVGAHLRRVPHLGPRHRDTQGGGAHRL 504 R RP +GG A L P GP R G AHRL Sbjct: 689 RARPVQGGAAALLPDAPARGPAGRRRVLGAAHRL 790
>LOC_Os02g11960:12002.t00994:unspliced-genomic ATATH5, putative| Length = 7022 Score = 31.8 bits (63), Expect = 5.1 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 / -3 Query: 145 HGIPRRAPAVVDGCQGHEAPRAGDVQGEAD 234 HG APA VDG G E P+ DV G+ + Sbjct: 642 HGNAAAAPAAVDGGGGGELPQHLDVDGDLE 553
>LOC_Os02g02490:12002.t00148:unspliced-genomic phytosulfokine receptor precursor, putative, expressed| Length = 4228 Score = 31.8 bits (63), Expect = 5.1 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 / +2 Query: 247 ALRRDQLHLVRRLRAEPHAPGSRRRQRER 161 A RR Q H+VRRLR + P RRR R Sbjct: 968 ARRRRQAHVVRRLREQLRRPRRRRRPVRR 1054
>LOC_Os11g42310:12011.t03762:unspliced-genomic F-box domain containing protein| Length = 1776 Score = 26.7 bits (52), Expect(2) = 5.5 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 / +2 Query: 110 PFSVCAAAPSAPMASRVALPLSSTAAR 190 P C +PSAP ASR P S +R Sbjct: 776 PAPCCGRSPSAPAASRSRPPSPSLPSR 856 Score = 25.4 bits (49), Expect(2) = 5.5 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 / +3 Query: 445 RVPHLGPRHRDTQGGGAHRL 504 R+PH PR R Q HR+ Sbjct: 1095 RLPHAPPRRRGRQTAARHRV 1154
>LOC_Os10g17780:12010.t01334:unspliced-genomic oxidoreductase, FAD-binding family protein| Length = 1368 Score = 27.6 bits (54), Expect(2) = 5.9 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPMASRVALPLSSTAARGMRLRAQAT 217 RSS A + +S P + C+A+PSA + S A R RA +T Sbjct: 335 RSSPATSASSASRCRPLTRCSASPSASTS*SAPASKGSCACERTRRRAWST 487 Score = 24.0 bits (46), Expect(2) = 5.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 / +1 Query: 385 VRPELPRRRPDRGGVGAHL 441 V P PRRR RGG G L Sbjct: 1105 VPPGAPRRRGGRGGDGLPL 1161
>LOC_Os01g24950:12001.t02214:unspliced-genomic exocyst complex subunit Sec15-like family protein, expressed| Length = 5307 Score = 25.8 bits (50), Expect(2) = 6.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 / -3 Query: 442 RRVPHLGPRHRDTQGGGAHR 501 RRV L P+HRD G G R Sbjct: 100 RRVAGLPPQHRDLGGRGGGR 41 Score = 22.6 bits (43), Expect(2) = 6.2 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +1 / -3 Query: 397 LPRRRPDRG 423 +PRRRP+RG Sbjct: 247 VPRRRPERG 221
>LOC_Os11g16840:12011.t01464:unspliced-genomic hypothetical protein| Length = 2918 Score = 30.4 bits (60), Expect(2) = 6.3 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 2022 RSSWKMKALVSSSCLPSSACGRRPSLPL 1939 Score = 22.1 bits (42), Expect(2) = 6.3 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 1938 FPVCLCVC 1915
>LOC_Os06g18670:12006.t01690:unspliced-genomic anthocyanidin 3-O-glucosyltransferase, putative, expressed| Length = 1783 Score = 25.4 bits (49), Expect(2) = 6.7 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -1 / -2 Query: 77 RRSCELAREGTTPWTDSST 21 RR C R G PW+ ST Sbjct: 1071 RRGCRRRRRGPPPWS*GST 1015 Score = 23.1 bits (44), Expect(2) = 6.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 / -2 Query: 208 RAEPHAPGSRRRQR 167 RA APG+RRR R Sbjct: 1110 RAPARAPGTRRRAR 1069
>LOC_Os03g52760:12003.t04599:unspliced-genomic carbohydrate kinase, PfkB, putative, expressed| Length = 3209 Score = 30.9 bits (61), Expect(2) = 6.9 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 / +1 Query: 403 RRRPDRGGVGAHLRRVPHLGPRHRDTQGGGAHR 501 RRRP RG G +R P G + GGGA R Sbjct: 901 RRRPPRGAGGHAVRAAPPAGGVPQGVLGGGAVR 999 Score = 21.7 bits (41), Expect(2) = 6.9 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 / +1 Query: 385 VRPELPRRRP 414 +RP+LPRR P Sbjct: 724 LRPDLPRRPP 753
>LOC_Os08g20870:12008.t01896:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3217 Score = 30.4 bits (60), Expect(2) = 6.9 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSWKMKALVSSSCLPSSACGRRPSLPL 731 Score = 22.1 bits (42), Expect(2) = 6.9 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 732 FPVCLCVC 755
>LOC_Os08g40870:12008.t03817:unspliced-genomic pentatricopeptide repeat protein, putative, expressed| Length = 1182 Score = 26.7 bits (52), Expect(2) = 6.9 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 / -1 Query: 385 VRPELPRRRPDRGGVGAHLRRVPHLGPRHRDTQG 486 VR E PRRR G ++ + GPR R+ G Sbjct: 315 VRREEPRRRGAEARRGGAVQELRPHGPRRREVAG 214 Score = 24.4 bits (47), Expect(2) = 6.9 Identities = 12/48 (25%), Positives = 21/48 (43%) Frame = +2 / -2 Query: 98 SLRLPFSVCAAAPSAPMASRVALPLSSTAARGMRLRAQATYKVKLITP 241 S R S+C P A ALP++ + R R ++ ++ +P Sbjct: 572 SRRYAASICGTVPDAA*WHTKALPVAESTGRPWRAISRTASSMRASSP 429
>LOC_Os06g31910:12006.t02890:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4628 Score = 30.9 bits (61), Expect(2) = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 651 RSSWKMKALVSSSYLPSSACGRRPSLPL 734 Score = 22.1 bits (42), Expect(2) = 7.0 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 534 FPACACIC 557 FP C C+C Sbjct: 735 FPVCLCVC 758
>LOC_Os12g34180:12012.t03107:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass, expressed| Length = 6728 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 723 RSSLKMKALVSSSCLPSSACGRRPSLPL 806
>LOC_Os12g34090:12012.t03098:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6734 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 723 RSSLKMKALVSSSCLPSSACGRRPSLPL 806
>LOC_Os12g30214:12012.t02728:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6641 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os12g28920:12012.t02602:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6723 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 727 RSSLKMKALVSSSCLPSSACGRRPSLPL 810
>LOC_Os12g27160:12012.t02430:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2229 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 650 RSSLKMKALVSSSCLPSSACGRRPSLPL 733
>LOC_Os12g27150:12012.t02429:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6652 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 650 RSSLKMKALVSSSCLPSSACGRRPSLPL 733
>LOC_Os12g26580:12012.t02371:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4372 Score = 31.3 bits (62), Expect = 7.0 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPMAS 154 RSS M +VSS LP S C PS P+ S Sbjct: 3829 RSSWKMKALVSSSCLPSSACGRRPSLPLFS 3740
>LOC_Os12g23590:12012.t02089:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4051 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 1829 RSSLKMKALVSSSCLPSSACGRRPSLPL 1746
>LOC_Os12g23580:12012.t02088:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6747 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 725 RSSLKMKALVSSSCLPSSACGRRPSLPL 808
>LOC_Os12g19930:12012.t01836:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4688 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 3513 RSSLKMKALVSSSCLPSSACGRRPSLPL 3596
>LOC_Os12g19910:12012.t01834:unspliced-genomic hypothetical protein| Length = 1945 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 725 RSSLKMKALVSSSCLPSSACGRRPSLPL 808
>LOC_Os11g44740:12011.t04002:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1628 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 724 RSSLKMKALVSSSCLPSSACGRRPSLPL 807
>LOC_Os11g44730:12011.t04001:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6731 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 724 RSSLKMKALVSSSCLPSSACGRRPSLPL 807
>LOC_Os11g33458:12011.t02941:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1740 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os10g38970:12010.t03138:unspliced-genomic expressed protein| Length = 8867 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -3 / +3 Query: 186 AAVDDSGSATRDAMGAEGAAAQTEKGK 106 AA + G A R AMGAE AA+ E+G+ Sbjct: 6465 AA*AEQGRARRGAMGAERGAARNERGR 6545
>LOC_Os10g37070:12010.t02980:unspliced-genomic cytochrome P450 89A2, putative| Length = 1269 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 / +3 Query: 391 PELPRRRPDRGGVGAHLRRVPHLGPRHRDTQGG 489 P P +GG G RRVPH RH + GG Sbjct: 777 PTEPHPAAAQGGGGHRRRRVPHPQGRHGELHGG 875
>LOC_Os10g37034:12010.t02977:unspliced-genomic cytochrome P450 family protein| Length = 3465 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 / +3 Query: 400 PRRRPDRGGVGAHLRRVPHLGPRHRDTQGG 489 P R +GG G RRVPH RH + GG Sbjct: 3015 PLRAAAQGGGGHGRRRVPHPQGRHGELHGG 3104
>LOC_Os10g36960:12010.t02969:unspliced-genomic transposon protein, putative, unclassified| Length = 1602 Score = 31.3 bits (62), Expect = 7.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 / +3 Query: 412 PDRGGVGAHLRRVPHLGPRHRDTQGG 489 P +GG G RRVPH RH + GG Sbjct: 1206 PAQGGRGRRGRRVPHPQGRHGELHGG 1283
>LOC_Os10g29190:12010.t02264:unspliced-genomic speckle-type POZ protein, putative, expressed| Length = 1145 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 / -3 Query: 388 RPELPRRRPDRGGVGAHLRRVPHLGPRHRDTQGGGA 495 RP PRRRP R G G R R ++ GG+ Sbjct: 582 RPRTPRRRPSRSPAGRRAAGSCRTGARTRRSRRGGS 475
>LOC_Os10g20020:12010.t01499:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6725 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 724 RSSLKMKALVSSSCLPSSACGRRPSLPL 807
>LOC_Os10g16910:12010.t01253:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6668 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os10g16600:12010.t01225:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6668 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os10g16480:12010.t01213:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6750 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 725 RSSLKMKALVSSSCLPSSACGRRPSLPL 808
>LOC_Os10g16470:12010.t01212:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2736 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 319 RSSLKMKALVSSSCLPSSACGRRPSLPL 402
>LOC_Os10g12808:12010.t01058:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6672 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os10g12770:12010.t01053:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6752 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 730 RSSLKMKALVSSSCLPSSACGRRPSLPL 813
>LOC_Os10g12760:12010.t01052:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6630 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 730 RSSLKMKALVSSSCLPSSACGRRPSLPL 813
>LOC_Os10g12670:12010.t01043:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6671 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os10g11690:12010.t00965:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6671 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os10g09400:12010.t00757:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6718 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 724 RSSLKMKALVSSSCLPSSACGRRPSLPL 807
>LOC_Os10g06170:12010.t00486:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6659 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os09g30486:12009.t02735:unspliced-genomic fasciclin-like arabinogalactan protein 7 precursor, putative,| expressed Length = 1857 Score = 31.3 bits (62), Expect = 7.0 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 / +2 Query: 400 PRRRPDRGGVGAHLRRVPHLGPRHRDTQGGG 492 PRR P RG H+ ++P RHRD G Sbjct: 1007 PRRAPQRGRAVPHVPQLPGEDERHRDVPEPG 1099
>LOC_Os09g23930:12009.t02076:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2061 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 1080 RSSLKMKALVSSSCLPSSACGRRPSLPL 997
>LOC_Os09g23920:12009.t02075:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6003 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 4 RSSLKMKALVSSSCLPSSACGRRPSLPL 87
>LOC_Os09g17410:12009.t01527:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6669 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os09g09770:12009.t00769:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6402 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSMKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os09g08830:12009.t00677:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3193 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 647 RSSLKMKALVSSSCLPSSACGRRPSLPL 730
>LOC_Os09g01070:12009.t00009:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5311 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 725 RSSLKMKALVSSSCLPSSACGRRPSLPL 808
>LOC_Os09g01060:12009.t00008:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6746 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 725 RSSLKMKALVSSSCLPSSACGRRPSLPL 808
>LOC_Os08g35390:12008.t03279:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5808 Score = 31.3 bits (62), Expect = 7.0 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 / -3 Query: 241 RRDQLHLVRRLRAEPHAPGSRRRQRER 161 +R+++HL RR R P APG+ +R R Sbjct: 1687 KRERMHLHRRWRRWPQAPGTPGHRRHR 1607
>LOC_Os08g27930:12008.t02551:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1708 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os08g27890:12008.t02547:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1723 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os08g26920:12008.t02456:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 8307 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 2286 RSSLKMKALVSSSCLPSSACGRRPSLPL 2369
>LOC_Os08g24570:12008.t02227:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6674 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os08g24560:12008.t02226:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6726 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 723 RSSLKMKALVSSSCLPSSACGRRPSLPL 806
>LOC_Os08g20849:12008.t01894:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6723 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 723 RSSLKMKALVSSSCLPSSACGRRPSLPL 806
>LOC_Os08g20350:12008.t01853:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6526 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 536 RSSLKMKALVSSSCLPSSACGRRPSLPL 619
>LOC_Os08g14540:12008.t01329:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2456 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 1513 RSSLKMKALVSSSCLPSSACGRRPSLPL 1430
>LOC_Os08g14530:12008.t01328:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6744 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 725 RSSLKMKALVSSSCLPSSACGRRPSLPL 808
>LOC_Os08g12290:12008.t01109:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6755 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 729 RSSLKMKALVSSSCLPSSACGRRPSLPL 812
>LOC_Os08g12280:12008.t01108:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3677 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 729 RSSLKMKALVSSSCLPSSACGRRPSLPL 812
>LOC_Os08g11930:12008.t01073:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6672 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os08g11910:12008.t01071:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4363 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 3466 RSSLKMKALVSSSCLPSSACGRRPSLPL 3383
>LOC_Os08g11790:12008.t01059:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6644 Score = 31.3 bits (62), Expect = 7.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M VSS LP S C PS PM Sbjct: 647 RSSLKMKASVSSSCLPSSACGRRPSLPM 730
>LOC_Os08g11780:12008.t01058:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6674 Score = 31.3 bits (62), Expect = 7.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M VSS LP S C PS PM Sbjct: 647 RSSLKMKASVSSSCLPSSACGRRPSLPM 730
>LOC_Os08g03130:12008.t00207:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6725 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 726 RSSLKMKALVSSSCLPSSACGRRPSLPL 809
>LOC_Os07g38340:12007.t03500:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6667 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os07g30880:12007.t02775:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6723 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 726 RSSLKMKALVSSSCLPSSACGRRPSLPL 809
>LOC_Os07g17800:12007.t01639:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6671 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSACGCHPSLPL 732
>LOC_Os07g16850:12007.t01545:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6751 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 729 RSSLKMKALVSSSCLPSSACGRRPSLPL 812
>LOC_Os07g16720:12007.t01532:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4557 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 499 RSSLKMKALVSSSCLPSSACGRRPSLPL 582
>LOC_Os07g16560:12007.t01516:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6575 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os06g32820:12006.t02979:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5911 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 722 RSSLKMKALVSSSCLPSSACGRRPSLPL 805
>LOC_Os06g32050:12006.t02903:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6670 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os06g31420:12006.t02843:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5581 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 4612 RSSLKMKALVSSSCLPSSACGRRPSLPL 4529
>LOC_Os06g19470:12006.t01766:unspliced-genomic WW domain containing protein, expressed| Length = 8457 Score = 31.3 bits (62), Expect = 7.0 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -3 / +2 Query: 672 FFFLGKLTQALISNQIPTTAASTNYSVTPQYPDTVH 565 +FFLG + L SNQ P ST + T P T H Sbjct: 6269 YFFLGIILSHLSSNQTP*KMGSTQPNPTHSIPGTKH 6376
>LOC_Os06g16900:12006.t01563:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4354 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 319 RSSLKMKALVSSSCLPSSACGRRPSLPL 402
>LOC_Os06g16890:12006.t01562:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6662 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 724 RSSLKMKALVSSSCLPSSACGRRPSLPL 807
>LOC_Os05g26190:12005.t02273:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1903 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os05g26170:12005.t02271:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 8126 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os05g23080:12005.t01966:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6734 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 724 RSSLKMKALVSSSCLPSSACGRRPSLPL 807
>LOC_Os05g22470:12005.t01908:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2436 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 268 RSSRRMKALVSSSCLPSSACGRRPSLPL 185
>LOC_Os05g20220:12005.t01783:unspliced-genomic transposon protein, putative, unclassified| Length = 1297 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSRRMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os05g18604:12005.t004711:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass, expressed| Length = 33185 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 19858 RSSLKMKALVSSSCLPSSACGRRPSLPL 19941
>LOC_Os05g18500:12005.t01617:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3912 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 3005 RSSLKMKALVSSSCLPSSACGRRPSLPL 2922
>LOC_Os05g18490:12005.t01616:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6674 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os05g18380:12005.t01605:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass, expressed| Length = 6671 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 647 RSSLKMKALVSSSCLPSSACGRRPSLPL 730
>LOC_Os05g17910:12005.t01560:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4645 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 645 RSSLKMKALVSSSCLPSSACGRRPSLPL 728
>LOC_Os05g17770:12005.t01546:unspliced-genomic transposon protein, putative, unclassified| Length = 2437 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 1531 RSSLKMKVLVSSSCLPSSACGRRPSLPL 1448
>LOC_Os05g17670:12005.t01536:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 3436 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 729 RSSLKMKALVSSSCLPSSACGRRPSLPL 812
>LOC_Os05g17530:12005.t01522:unspliced-genomic transposon protein, putative, unclassified| Length = 2012 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os05g17520:12005.t01521:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1777 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os05g17410:12005.t01510:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6649 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 650 RSSLKMKALVSSSCLPSSACGRRPSLPL 733
>LOC_Os05g17320:12005.t01501:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6749 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 724 RSSLKMKALVSSSCLPSSACGRRPSLPL 807
>LOC_Os05g17260:12005.t01495:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6750 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 729 RSSLKMKALVSSSCLPSSACGRRPSLPL 812
>LOC_Os05g16720:12005.t01442:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6719 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 723 RSSLKMKALVSSSCLPSSACGRRPSLPL 806
>LOC_Os05g16710:12005.t01441:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2201 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 1223 RSSLKMKALVSSSCLPSSACGRRPSLPL 1140
>LOC_Os04g56280:12004.t05099:unspliced-genomic hypothetical protein| Length = 1157 Score = 31.3 bits (62), Expect = 7.0 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 / +3 Query: 154 PRRAPAVVDGCQGHEAPRAGDVQG 225 PRRA AVV G +GH R G + G Sbjct: 624 PRRARAVVAGARGHRGRRGGRLGG 695
>LOC_Os04g49080:12004.t04424:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative| Length = 904 Score = 31.3 bits (62), Expect = 7.0 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +1 / -2 Query: 391 PELPRRRPDRGGVGAHLRRVPHLGPRHRDTQGGGAHRL 504 P P RP R + LRR HL PR R + HRL Sbjct: 519 PPQPLLRPLRHHLRCPLRRRLHLRPRRRSSSPPSVHRL 406
>LOC_Os04g48380:12004.t04355:unspliced-genomic lysM domain containing protein| Length = 360 Score = 31.3 bits (62), Expect = 7.0 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = -3 / -2 Query: 213 ACARSLMPLAAVDDSGSATRDAMGAEGAAAQTEKGKRRLLTTVAIAA 73 A ARS + + + DA A AAA +RRL+ VA+AA Sbjct: 152 ASARSAHSSTSATSATAKHHDAASAADAAAAHSSARRRLVLVVAVAA 12
>LOC_Os04g45980:12004.t04130:unspliced-genomic ATP-dependent RNA helicase A, putative, expressed| Length = 576 Score = 31.3 bits (62), Expect = 7.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 / -3 Query: 466 RHRDTQGGGAHRLNSLILCISIRFRRARVYARC 564 RHR +G +HR +L + +R RR++ RC Sbjct: 286 RHRGRRGRWSHRARQRLLHLRLRRRRSQTRTRC 188
>LOC_Os04g26670:12004.t02373:unspliced-genomic transposon protein, putative, unclassified| Length = 1106 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 730 RSSLKMKALVSSSCLPSSACGRRPSLPL 813
>LOC_Os04g26660:12004.t02372:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6613 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 729 RSSLKMKALVSSSCLPSSACGCHPSLPL 812
>LOC_Os04g21220:12004.t01855:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5152 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 722 RSSLKMKALVSSSCLPSSACGRRPSLPL 805
>LOC_Os04g21210:12004.t01854:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6719 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 724 RSSLKMKALVSSSCLPSSACGRRPSLPL 807
>LOC_Os04g13850:12004.t01204:unspliced-genomic transposon protein, putative, unclassified| Length = 1292 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os04g13810:12004.t01200:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3530 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 2587 RSSLKMKALVSSSCLPSSACGRRPSLPL 2504
>LOC_Os04g10120:12004.t00845:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2243 Score = 31.3 bits (62), Expect = 7.0 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +2 / +1 Query: 47 YLPELARSSAAMATVVSSLRLPFSVCAAAPS 139 + P RSS M +VSSL LP S C PS Sbjct: 685 FSPTQKRSSWKMKALVSSLCLPSSACGRRPS 777
>LOC_Os04g05170:12004.t00399:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4152 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 725 RSSLKMKALVSSSCLPSSACGRRPSLPL 808
>LOC_Os04g03410:12004.t00231:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4137 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 648 RSSLKMKALVSSSCLPSSACGRRPSLPL 731
>LOC_Os04g02620:12004.t00155:unspliced-genomic steroid dehydrogenase let-767, putative, expressed| Length = 2527 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 / -1 Query: 403 RRRPDRGGVGAHLRRVPHLGPRHRDTQGGGAHR 501 +RR GG GA + PRHR GGG R Sbjct: 655 KRRDGDGGAGADVDDGSPAAPRHRRQHGGGHRR 557
>LOC_Os03g23850:12003.t02080:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1970 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 719 RSSLKMKALVSSSCLPSSACGRRPSLPL 802
>LOC_Os03g23820:12003.t02077:unspliced-genomic hypothetical protein| Length = 1290 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / -3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 412 RSSLKMKALVSSSCLPSSACGRRPSLPL 329
>LOC_Os03g23800:12003.t02075:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass, expressed| Length = 6735 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 723 RSSLEMKALVSSSCLPSSACGRRPSLPL 806
>LOC_Os03g23790:12003.t02074:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1887 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 1154 RSSLEMKALVSSSCLPSSACGRRPSLPL 1237
>LOC_Os03g23200:12003.t02066:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 7891 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 649 RSSLKMKALVSSSCLPSSACGRRPSLPL 732
>LOC_Os03g18980:12003.t01665:unspliced-genomic kinesin-4, putative, expressed| Length = 5719 Score = 31.3 bits (62), Expect = 7.0 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 / +3 Query: 409 RPDRGGVGAHLRRVPHLGPRHRDTQGGGAHRLNSLILC 522 R RGG A RVP PR R QGGG+ + ++ C Sbjct: 33 RGRRGGGRAAAARVPPQRPRPRLPQGGGSRCVCRVVSC 146
>LOC_Os03g15790:12003.t01365:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 2020 Score = 31.3 bits (62), Expect = 7.0 Identities = 20/62 (32%), Positives = 26/62 (41%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPMASRVALPLSSTAARGMRLRAQATYKVKLITPE 244 R AA A VV P V A A +A RVA+P+ + AA A + P Sbjct: 556 RVVAARAVVVVPASAPGLVVGGAVHAVVAMRVAVPVPALAAVSQHYSCGAVVAAQQADPS 735 Query: 245 GE 250 G+ Sbjct: 736 GD 741
>LOC_Os02g38620:12002.t03500:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3412 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 725 RSSLKMKALVSSSCLPSSACGRRPSLPL 808
>LOC_Os02g30010:12002.t02694:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2648 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS +M +VSS LP S C+ PS P+ Sbjct: 646 RSSWSMKALVSSSCLPSSACSRRPSFPL 729
>LOC_Os02g16420:12002.t01435:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4030 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 2852 RSSLKMKALVSSSCLPSSACGRRPSLPL 2935
>LOC_Os02g16350:12002.t01428:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2358 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 65 RSSAAMATVVSSLRLPFSVCAAAPSAPM 148 RSS M +VSS LP S C PS P+ Sbjct: 1180 RSSLKMKALVSSSCLPSSACGRRPSLPL 1263 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 176,354,537 Number of extensions: 2252934 Number of successful extensions: 20294 Number of sequences better than 10.0: 293 Length of query: 225 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 177 Effective length of database: 52,912,542 Effective search space: 9365519934 Effective search space used: 9365519934 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
