| Clone Name | FLbaf45j07 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os05g49250:12005.t04358:unspliced-genomic DNA-3-methyladenine glycosylase 1, putative, expressed| Length = 5446 Score = 26.7 bits (52), Expect(2) = 0.50 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 / +1 Query: 437 QRLLMIRWRW*WCLVGVACP 378 QR + WRW C G ACP Sbjct: 2980 QRT*CLPWRWPPCPTGWACP 3039 Score = 25.4 bits (49), Expect(2) = 0.50 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 / +3 Query: 587 FFFFFGIKAEAPCIFRIG 534 FFFFF + + PC+ +G Sbjct: 2856 FFFFFLPQVQYPCVLYLG 2909
>LOC_Os05g49240:12005.t04357:unspliced-genomic SANT/MYB protein, putative, expressed| Length = 1546 Score = 26.7 bits (52), Expect(2) = 0.54 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 / -3 Query: 437 QRLLMIRWRW*WCLVGVACP 378 QR + WRW C G ACP Sbjct: 266 QRT*CLPWRWPPCPTGWACP 207 Score = 25.4 bits (49), Expect(2) = 0.54 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 / -2 Query: 587 FFFFFGIKAEAPCIFRIG 534 FFFFF + + PC+ +G Sbjct: 390 FFFFFLPQVQYPCVLYLG 337
>LOC_Os09g22370:12009.t01970:unspliced-genomic hypothetical protein| Length = 2125 Score = 33.6 bits (67), Expect = 1.2 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 / +3 Query: 467 RFYFIQRARMQRLLMIRWRW*WCLVGVACPPLILVLASAGRP 342 RF+F+Q A ++RL R RW L P V ++AG P Sbjct: 885 RFFFVQFAHLERLKWRRRRWLGALPRPNLPACFRVSSTAGEP 1010
>LOC_Os02g37190:12002.t03357:unspliced-genomic expressed protein| Length = 1163 Score = 33.1 bits (66), Expect = 1.7 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 / -1 Query: 479 RTRRRFYFIQRARMQRLLMIRWRW 408 R RRRF + R R +R+L++R RW Sbjct: 677 RRRRRFVLVVRRRRRRVLVVRRRW 606
>LOC_Os05g35200:12005.t03113:unspliced-genomic secondary cell wall-related glycosyltransferase family 8, putative,| expressed Length = 5336 Score = 33.1 bits (66), Expect = 1.7 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 / -2 Query: 396 GWCCLSSSHPRARLCRPASR 337 G C L SSHP A C P+SR Sbjct: 4981 GCCSLGSSHPNAAACSPSSR 4922
>LOC_Os02g41600:12002.t03746:unspliced-genomic hypothetical protein| Length = 548 Score = 33.1 bits (66), Expect = 1.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 / -3 Query: 23 PHSSQHIAFLPSPPPTKERSMS 88 P SS H P+PPPT+ R MS Sbjct: 141 PASSSHRCHAPTPPPTRRRGMS 76
>LOC_Os01g13480:12001.t01210:unspliced-genomic electron transporter/ thiol-disulfide exchange intermediate,| putative, expressed Length = 1532 Score = 33.1 bits (66), Expect = 1.7 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -2 / +2 Query: 366 RARLCRPASRAPAHLQLQQEQPHAVPHL 283 R R R R A Q+Q+E+PHAVPHL Sbjct: 1190 RRRRHRRRRRRRAVRQVQRERPHAVPHL 1273
>LOC_Os06g13340:12006.t01209:unspliced-genomic hypothetical protein| Length = 1652 Score = 32.7 bits (65), Expect = 2.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 / -1 Query: 390 TNQAPSPSPSYHQ*PLHARALNKIKP 467 T PSPS S H P+H RA K++P Sbjct: 803 TKSPPSPSSSSHLSPIHERAQAKLEP 726
>LOC_Os01g15790:12001.t01430:unspliced-genomic expressed protein| Length = 7556 Score = 32.7 bits (65), Expect = 2.3 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 / +1 Query: 422 IRWRW*WCLVGVACPPLILVLASAGRPP 339 + WRW W + A PL L +AG PP Sbjct: 64 VEWRWRWRTLAAARAPLRLSPPAAGHPP 147
>LOC_Os03g47850:12003.t04147:unspliced-genomic conserved hypothetical protein| Length = 603 Score = 32.7 bits (65), Expect = 2.3 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 / -3 Query: 5 KQAHQPPHSSQHIAFLPSPPPTKER 79 ++ +PPH + ++LP+PPP R Sbjct: 148 RRGRRPPHPTSSASYLPAPPPAASR 74
>LOC_Os10g12760:12010.t01052:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6630 Score = 25.4 bits (49), Expect(2) = 2.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 / -3 Query: 375 RRTSNTNQAPSPSP 416 RRTS +NQ P P P Sbjct: 2191 RRTSESNQRPPPCP 2150 Score = 24.0 bits (46), Expect(2) = 2.9 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 / -3 Query: 462 KPPSCSLVLYALRVAFDQCVLPHASDP 542 +PP C + ALR + + HA P Sbjct: 2167 RPPPCPIPTLALRRTLRRALCAHAVSP 2087
>LOC_Os03g13500:12003.t01144:unspliced-genomic transposon protein, putative, unclassified| Length = 1557 Score = 26.7 bits (52), Expect(2) = 3.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 / -2 Query: 485 SVCPACSVRPVCPSSCLRS 541 +VC C R CP++C R+ Sbjct: 509 AVCAVCVTRSRCPAACSRA 453 Score = 25.4 bits (49), Expect(2) = 3.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 / -2 Query: 20 PPHSSQHIAFLPSPPPTK 73 PP S I+ PSPPP++ Sbjct: 803 PPGSMGRISLGPSPPPSR 750
>LOC_Os03g02860:12003.t00174:unspliced-genomic metal ion binding protein, putative, expressed| Length = 2238 Score = 31.8 bits (63), Expect = 4.3 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 / -3 Query: 378 RTSNTNQAPSPSPSYHQ*PLHARALNKIKP 467 RT + + +PSP+P PLHA ++IKP Sbjct: 1621 RTPSPSPSPSPTPPPPNQPLHACKFHQIKP 1532
>LOC_Os02g55880:12002.t05162:unspliced-genomic calcineurin subunit B, putative, expressed| Length = 2987 Score = 31.8 bits (63), Expect = 4.3 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 / +1 Query: 464 FYFIQRARMQRLLMIRWRW*WCLVGVACPPLILV 363 F+F +R+ +L RWRW L C PL+LV Sbjct: 2482 FFFPYVSRL*IILA*RWRWKCLLTSGPCIPLVLV 2583
>LOC_Os08g37140:12008.t03451:unspliced-genomic phosphoglycerate mutase gpmB, putative, expressed| Length = 3865 Score = 31.8 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -2 / -1 Query: 384 LSSSHPRARLCRPASRAPAH 325 L++S+PR R CRP+S P+H Sbjct: 2110 LTTSNPRHRHCRPSSTIPSH 2051
>LOC_Os01g63354:12001.t05704:unspliced-genomic ELM2, putative, expressed| Length = 5188 Score = 26.7 bits (52), Expect(2) = 5.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 / -3 Query: 446 ARMQRLLMIRWRW*W 402 AR+QR L WRW W Sbjct: 278 ARLQRQLTRMWRWRW 234 Score = 26.3 bits (51), Expect(2) = 5.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 / -3 Query: 543 SDRRHEEGHTGRTLHAGHTE 484 SDR +E+G TG+ GH E Sbjct: 830 SDRFYEQGRTGQLSTRGHCE 771
>LOC_Os05g11960:12005.t01026:unspliced-genomic hypothetical protein| Length = 3244 Score = 31.3 bits (62), Expect = 5.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 / +1 Query: 479 RTRRRFYFIQRARMQRLLMIRWRW 408 RTRRR F++R L +RW+W Sbjct: 592 RTRRRSAFVERRHPAANLTLRWQW 663
>LOC_Os02g54530:12002.t05032:unspliced-genomic pathogenesis-related protein PR-1 precursor, putative, expressed| Length = 571 Score = 31.3 bits (62), Expect = 5.9 Identities = 17/59 (28%), Positives = 23/59 (38%) Frame = +3 / -2 Query: 381 TSNTNQAPSPSPSYHQ*PLHARALNKIKPPSCSLVLYALRVAFDQCVLPHASDPKYTWR 557 T++ P+P P P +PP L A R A+D + H S TWR Sbjct: 354 TTSAGAHPTPLPWNRFSPYGPCECTSAQPPPAPLRAAAYRAAYDASLSSHRSGGTPTWR 178
>LOC_Os02g36300:12002.t03267:unspliced-genomic RING-H2 finger protein ATL2G precursor, putative, expressed| Length = 1281 Score = 31.3 bits (62), Expect = 5.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 / +2 Query: 473 RRRFYFIQRARMQRLLMIRWRW*WCLVGVAC 381 R R R + RL ++RWRW W V C Sbjct: 191 RPRLRMRHRQPVLRLRLLRWRWGWARAVVGC 283
>LOC_Os11g31780:12011.t02775:unspliced-genomic hypothetical protein| Length = 1563 Score = 31.3 bits (62), Expect = 5.9 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 / -1 Query: 378 SSHPRARLCRPASRAPAHLQLQQEQPHAVP 289 ++ P A CRPA R PA+ +L++ P P Sbjct: 870 ANEPAAARCRPARRPPAYARLRRPPPCVRP 781
>LOC_Os11g08530:12011.t00744:unspliced-genomic expressed protein| Length = 2926 Score = 31.3 bits (62), Expect = 5.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 / +3 Query: 340 GGRPAEASTRMRGGQATPT 396 GGRP+ A RGG++TPT Sbjct: 2682 GGRPSPADALRRGGESTPT 2738
>LOC_Os05g02070:12005.t00106:unspliced-genomic metallothionein-like protein type 2, putative, expressed| Length = 1112 Score = 31.3 bits (62), Expect = 5.9 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +2 / +3 Query: 152 KMFPDVEATAGAAAMVMPTASHK 220 KMFPDVEATA V+ S+K Sbjct: 387 KMFPDVEATATTKTFVLAAPSNK 455
>LOC_Os03g51870:12003.t04515:unspliced-genomic kinetoplast-associated protein, putative, expressed| Length = 3646 Score = 31.3 bits (62), Expect = 5.9 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 / -2 Query: 337 PGGRPAEASTRMRGGQATPTK 399 P RPA TR RGG ATP + Sbjct: 549 PTARPAAGGTRWRGGAATPRR 487
>LOC_Os02g18630:12002.t01656:unspliced-genomic expressed protein| Length = 1461 Score = 31.3 bits (62), Expect = 5.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 / +2 Query: 491 CPACSVRPVCPSSCLRSEI 547 CP RP+CP +C RS I Sbjct: 443 CPPRGSRPICPRTCTRSSI 499
>LOC_Os01g74300:12001.t06709:unspliced-genomic metallothionein-like protein type 2, putative, expressed| Length = 1007 Score = 31.3 bits (62), Expect = 5.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 / -1 Query: 324 LQLQQEQPHAVPHL 283 LQLQQEQP VPHL Sbjct: 713 LQLQQEQPQLVPHL 672
>LOC_Os01g39150:12001.t03447:unspliced-genomic LOB domain protein 11, putative| Length = 756 Score = 31.3 bits (62), Expect = 5.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 / +1 Query: 20 PPHSSQHIAFLPSPPPT 70 PP Q + FLP PPPT Sbjct: 511 PPQGQQQLLFLPPPPPT 561
>LOC_Os01g28882:12001.t02582:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8092 Score = 30.9 bits (61), Expect(2) = 6.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 / +3 Query: 558 GAMYISDRRHEEGHTGRTLHAGHTEL 481 G +Y SDRRH G TGR++ T + Sbjct: 3942 GDLYWSDRRHPLGQTGRSISVRPTSI 4019 Score = 22.6 bits (43), Expect(2) = 6.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 / +3 Query: 592 VFFFFFSGSKLRRHVY 545 +FF+FF+ SK RR + Sbjct: 2670 IFFWFFTRSKGRREEF 2717
>LOC_Os06g23504:12006.t02161:unspliced-genomic DTW domain containing protein, expressed| Length = 17991 Score = 24.9 bits (48), Expect(2) = 6.3 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +3 / +1 Query: 462 KPPSCSLVLYALRVAFDQCVLPHASDPKYTWRLSFDP 572 +PP C + ALR + HA P R +F+P Sbjct: 4468 RPPPCPIPTLALRRTQRRVQCAHAVSPGSRIR*AFEP 4578 Score = 23.1 bits (44), Expect(2) = 6.3 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 / +1 Query: 375 RRTSNTNQAPSPSP 416 RRTS +N P P P Sbjct: 4444 RRTSESNHRPPPCP 4485
>LOC_Os02g43700:12002.t03954:unspliced-genomic triacylglycerol lipase like protein, putative, expressed| Length = 2221 Score = 27.6 bits (54), Expect(2) = 6.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 / +2 Query: 497 ACSVRPVCPSSC 532 ACS R CPSSC Sbjct: 638 ACSTRSTCPSSC 673 Score = 24.0 bits (46), Expect(2) = 6.5 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +3 / +2 Query: 54 PRHRPPRK 77 PRHRPPR+ Sbjct: 326 PRHRPPRR 349
>LOC_Os01g68370:12001.t06193:unspliced-genomic protein viviparous, putative, expressed| Length = 3834 Score = 28.6 bits (56), Expect(2) = 7.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 / +1 Query: 14 HQPPHSSQHIAFLPSPPPTKERSMS 88 H PPH H P+PPP ++S Sbjct: 16 HPPPHLHAHRQTKPNPPPRLHLALS 90 Score = 23.5 bits (45), Expect(2) = 7.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 / +1 Query: 161 PDVEATAGAAAMVMPTASHK 220 P ATAGA ++ TAS K Sbjct: 1627 PQAAATAGAESLQRSTASEK 1686
>LOC_Os12g22839:12012.t004148:unspliced-genomic expressed protein| Length = 855 Score = 30.9 bits (61), Expect = 8.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 / +3 Query: 431 LLMIRWRW*WCLVGVACPPL 372 L +RWRW W + G PPL Sbjct: 300 LACVRWRWWWRMAGSRHPPL 359
>LOC_Os08g09850:12008.t00870:unspliced-genomic hypothetical protein| Length = 576 Score = 30.9 bits (61), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 / +3 Query: 14 HQPPHSSQHIAFLPSPPPTKERSMS 88 H PPHS +H PPP +E + S Sbjct: 354 HLPPHSRRHPLSCSCPPPPEEEAWS 428
>LOC_Os07g17560:12007.t04602:unspliced-genomic expressed protein| Length = 721 Score = 30.9 bits (61), Expect = 8.1 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -2 / +1 Query: 396 GWCCLSSSHPRARLCRPASRAPAHLQLQQEQPHAVPH 286 GW H RA C PASR L+LQ +PH Sbjct: 160 GWISPWDGHVRASPCPPASRCQPPLRLQLVP*PPLPH 270
>LOC_Os02g01890:12002.t00089:unspliced-genomic cytochrome P450 89A2, putative, expressed| Length = 1676 Score = 30.9 bits (61), Expect = 8.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 / -3 Query: 11 AHQPPHSSQHIAFLPSP 61 AH PPH+ +H +LP+P Sbjct: 1362 AHPPPHAERHHRYLPAP 1312
>LOC_Os01g27730:12001.t02474:unspliced-genomic guanine nucleotide-binding protein-like 3, putative, expressed| Length = 4677 Score = 30.9 bits (61), Expect = 8.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 / -1 Query: 517 HWSNATRRAYRTNEHDGGFILFS 449 HWSN+T + Y TNE G +F+ Sbjct: 1701 HWSNSTSKMYNTNETK*GAEIFN 1633
>LOC_Os01g25386:12001.t02255:unspliced-genomic multidrug resistance-associated protein 4, putative, expressed| Length = 17314 Score = 30.9 bits (61), Expect = 8.1 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 / -2 Query: 384 LSSSHPRARLCRPASRAPAHLQLQQEQPHAVP 289 L +SHP R RP R+P H L Q + VP Sbjct: 6606 LPTSHPHGRHPRPHRRSPLHRALVQLRARHVP 6511
>LOC_Os01g19220:12001.t01712:unspliced-genomic beta-D-xylosidase, putative, expressed| Length = 2895 Score = 30.9 bits (61), Expect = 8.1 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 / -1 Query: 369 PRARLCRPASRAPAHLQLQQEQPHAVPH 286 P AR A HL LQ+ PH VPH Sbjct: 405 PHARRAARAVAEVGHLLLQRHPPHEVPH 322
>LOC_Os04g20990:12004.t01833:unspliced-genomic tRNA-dihydrouridine synthase A, putative, expressed| Length = 13827 Score = 24.4 bits (47), Expect(2) = 8.7 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 / -1 Query: 462 KPPSCSLVLYALRVAFDQCVLPHASDP 542 +PP C + ALR + + HA P Sbjct: 6675 RPPPCPIPTLALRRTLHRALCAHAVSP 6595 Score = 23.1 bits (44), Expect(2) = 8.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 / -1 Query: 375 RRTSNTNQAPSPSP 416 RRTS +N P P P Sbjct: 6699 RRTSESNHRPPPCP 6658
>LOC_Os04g09380:12004.t00775:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 4906 Score = 28.1 bits (55), Expect(2) = 9.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 / +1 Query: 399 APSPSPSYHQ*PLHARALNKIKPPS 473 AP PSPSYH + A + +PPS Sbjct: 4729 APRPSPSYHMARGASAAETQAEPPS 4803 Score = 24.0 bits (46), Expect(2) = 9.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 / +3 Query: 32 SQHIAFLPSPPPTKERS 82 S H A P PPPT ++ Sbjct: 4617 SSHEALQPGPPPTPRKT 4667 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 168,857,663 Number of extensions: 2557843 Number of successful extensions: 17284 Number of sequences better than 10.0: 39 Length of query: 197 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 149 Effective length of database: 52,912,542 Effective search space: 7883968758 Effective search space used: 7883968758 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)