| Clone Name | FLbaf42k04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | O42700:TAL1_SCHPO Transaldolase - Schizosaccharomyces pombe (Fis... | 31 | 3.4 | 2 | P33485:VNUA_PRVKA Probable nuclear antigen - Pseudorabies virus ... | 30 | 5.8 | 3 | Q99MT2:MSH4_MOUSE MutS protein homolog 4 - Mus musculus (Mouse) | 30 | 9.8 |
|---|
>O42700:TAL1_SCHPO Transaldolase - Schizosaccharomyces pombe (Fission yeast)| Length = 322 Score = 31.2 bits (69), Expect = 3.4 Identities = 23/64 (35%), Positives = 29/64 (45%) Frame = +2 Query: 230 LILYFKAEGTMEERAIPKITQALEGMDGVSDLEVLVEEGIGSVVLTKATTVQATGVASNL 409 LI ++AEG ER + KI EG+ LE EEGI + + VQA A Sbjct: 115 LIKLYEAEGIGRERVLIKIASTYEGIQAAKQLE---EEGIHCNLTLLFSFVQAVACAEAN 171 Query: 410 VEAI 421 V I Sbjct: 172 VTLI 175
>P33485:VNUA_PRVKA Probable nuclear antigen - Pseudorabies virus (strain Kaplan) (PRV)| Length = 1733 Score = 30.4 bits (67), Expect = 5.8 Identities = 22/58 (37%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = +1 Query: 292 GSRGDGWRQ*PGGARRRRHRKC------------CVNEGDNGPSYRGGL-KPGGSHPG 426 G+ G G + GGARRRR R+ G GP RGGL +PG H G Sbjct: 992 GAGGPGAGEAGGGARRRRRRRWDDEAGLLGPERGQAGRGLRGPGPRGGLGEPGRGHVG 1049
>Q99MT2:MSH4_MOUSE MutS protein homolog 4 - Mus musculus (Mouse)| Length = 958 Score = 29.6 bits (65), Expect = 9.8 Identities = 23/69 (33%), Positives = 30/69 (43%) Frame = +3 Query: 339 KKASEVLC*RRRQRSKLPGWPQTWWKPSRELVSSCKLLASASRTSTRPMXXXXXXXXSQE 518 +KA E+L R++ + L P+ W PSR + LASASR ST S Sbjct: 43 RKAGEML---RQEAASLSSSPR--WTPSRRDAPCGRTLASASRPSTEGAMADRSSSSSSS 97 Query: 519 KEQTSKPAS 545 S P S Sbjct: 98 PAPASAPGS 106 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 71,213,713 Number of extensions: 1115776 Number of successful extensions: 3885 Number of sequences better than 10.0: 3 Number of HSP's gapped: 3877 Number of HSP's successfully gapped: 3 Length of query: 213 Length of database: 100,686,439 Length adjustment: 108 Effective length of query: 105 Effective length of database: 71,062,579 Effective search space: 7461570795 Effective search space used: 7461570795 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)