| Clone Name | FLbaf180o22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q4FNS3:Y343_PELUB UPF0085 protein SAR11_0343 - Pelagibacter ubique | 33 | 7.2 | 2 | O43100:CBF5_EMENI Centromere/microtubule-binding protein CBF5 - ... | 32 | 9.4 |
|---|
>Q4FNS3:Y343_PELUB UPF0085 protein SAR11_0343 - Pelagibacter ubique| Length = 274 Score = 32.7 bits (73), Expect = 7.2 Identities = 29/123 (23%), Positives = 45/123 (36%), Gaps = 13/123 (10%) Frame = +3 Query: 1005 KGDVEKRPMKSQIKPDEGSKSKTSYNTSGFSQNQGHQQPDSLHSLSEPPVQHFQTCQYAL 1184 KGD +K P S + N S + P H+L+E + + Q+ + Sbjct: 79 KGDEKKIPCFSVL-------GNLIMNFSKLLNQKASHVPSGQHALNEEYYERIEAIQFTM 131 Query: 1185 LHDSKNMEQFQDAIQLAFPGYGYPA------------YPFSNIPVVSNIQ-AEDHQTNPK 1325 HD N+ + D L G + Y NIP+V+ E + NPK Sbjct: 132 AHDDGNLVEDVDKADLILLGVSRTSKTPTSIYLANRGYKTLNIPLVNEQSIPESLKKNPK 191 Query: 1326 AAC 1334 +C Sbjct: 192 LSC 194
>O43100:CBF5_EMENI Centromere/microtubule-binding protein CBF5 - Emericella nidulans| (Aspergillus nidulans) Length = 481 Score = 32.3 bits (72), Expect = 9.4 Identities = 32/117 (27%), Positives = 46/117 (39%), Gaps = 1/117 (0%) Frame = +3 Query: 1527 LVPQAYSRRK-KNSDSLGSSGIIGENAPEQTSACHKEIHKIFGIPDDPFLEEKIYYELKD 1703 L P A ++K K+S L G A E T A K +K + PD ++ + D Sbjct: 354 LGPVALEKKKLKSSGKLDKYG----RANEATPAKWKSEYKDYSAPDGDSSQQAV-----D 404 Query: 1704 ALGKLDARTRLCIRDSLLRLAHSSSQRQIASDRTSSNKTKRDEDEVPENDVSNRRKR 1874 + K +A + + L S A D K KR E E PE +RK+ Sbjct: 405 VVAKEEASPK---EEPSLEANESKMDIDDAQDDEDKKKRKRHEGETPEERAERKRKK 458 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 429,784,153 Number of extensions: 9583006 Number of successful extensions: 26775 Number of sequences better than 10.0: 2 Number of HSP's gapped: 26757 Number of HSP's successfully gapped: 2 Length of query: 808 Length of database: 100,686,439 Length adjustment: 122 Effective length of query: 686 Effective length of database: 67,222,449 Effective search space: 46114600014 Effective search space used: 46114600014 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)