| Clone Name | FLbaf173c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q26240:NOS_RHOPR Nitric-oxide synthase, salivary gland - Rhodniu... | 30 | 8.0 | 2 | O60583:CCNT2_HUMAN Cyclin-T2 - Homo sapiens (Human) | 30 | 8.0 |
|---|
>Q26240:NOS_RHOPR Nitric-oxide synthase, salivary gland - Rhodnius prolixus| (Triatomid bug) Length = 1174 Score = 29.6 bits (65), Expect = 8.0 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = -2 Query: 364 NLPLMYKYDLHADTILAQHNHRPKNLKHHASMESMEGGC 248 N+ +++ + LH TI+ H+ +KH + + + GGC Sbjct: 381 NVAVLHSFQLHNVTIVDHHSAAESFMKHLENEQRLRGGC 419
>O60583:CCNT2_HUMAN Cyclin-T2 - Homo sapiens (Human)| Length = 730 Score = 29.6 bits (65), Expect = 8.0 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 371 TSRSSSNAKQYIRIHGSVH*FTASLCPPSPSFRQV 475 +S SSS+ KQYI H SV F L PP P QV Sbjct: 644 SSSSSSSVKQYISSHNSV--FNHPLPPPPPVTYQV 676 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 89,404,009 Number of extensions: 1697253 Number of successful extensions: 4131 Number of sequences better than 10.0: 2 Number of HSP's gapped: 4129 Number of HSP's successfully gapped: 2 Length of query: 192 Length of database: 100,686,439 Length adjustment: 107 Effective length of query: 85 Effective length of database: 71,336,874 Effective search space: 6063634290 Effective search space used: 6063634290 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)