| Clone Name | FLbaf166m01 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os11g07550:12011.t00646:unspliced-genomic hypothetical protein| Length = 1618 Score = 32.2 bits (64), Expect(2) = 0.10 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 / +2 Query: 111 NRRRLGWFCHRWHCSPARS 167 +RRR GW+C CSPAR+ Sbjct: 458 SRRRRGWWCLTRRCSPART 514 Score = 22.1 bits (42), Expect(2) = 0.10 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 / +2 Query: 87 ASITTTPPNRRR 122 A+ TTTPP+ RR Sbjct: 296 AAATTTPPSPRR 331
>LOC_Os11g12810:12011.t01168:unspliced-genomic sucrose-phosphate synthase, putative, expressed| Length = 7399 Score = 26.7 bits (52), Expect(2) = 0.31 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 / +1 Query: 126 GWFCHRWHCSPARS*PPRGA 185 G C RW CS AR P G+ Sbjct: 6811 GSTCPRWRCSSARRATPTGS 6870 Score = 25.8 bits (50), Expect(2) = 0.31 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 / +2 Query: 8 PPESRSRSKNLPISLSHSPTP 70 PP R+RS + P + SPTP Sbjct: 6686 PPPGRARSGDTPPPATPSPTP 6748
>LOC_Os12g09320:12012.t00811:unspliced-genomic amino acid carrier, putative| Length = 1407 Score = 34.1 bits (68), Expect = 0.74 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 / +2 Query: 102 TPPNRRRLGWFCHRWHCSPARS*PP 176 T P RRR G C RW SP+RS P Sbjct: 677 TSPPRRRRGGRCRRWATSPSRSPSP 751
>LOC_Os08g36040:12008.t03344:unspliced-genomic plant viral-response family protein, expressed| Length = 1212 Score = 34.1 bits (68), Expect = 0.74 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -3 / +3 Query: 212 RGYSMSL*SCSPRWLTPRWGAVPPVTKPSKASPIRW 105 RG + CS W RW PP + ASP RW Sbjct: 522 RGSRGTTTGCSSSWSPLRWSPPPPPSSSRGASPSRW 629
>LOC_Os08g22100:12008.t01994:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1296 Score = 30.9 bits (61), Expect(2) = 0.89 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 / -1 Query: 261 RWKVRTPPCVWPAHHHGQAWYLVHRWI 341 RW R CV AHH G A L H+ I Sbjct: 84 RWNGRVLRCVGVAHHQGHASQLSHKII 4 Score = 22.6 bits (43), Expect(2) = 0.89 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 / -3 Query: 123 LGWFCHRW 146 LGW+C RW Sbjct: 1279 LGWWC*RW 1256
>LOC_Os12g26480:12012.t02361:unspliced-genomic expressed protein| Length = 2474 Score = 33.6 bits (67), Expect = 1.0 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 / +2 Query: 11 PESRSRSKNLPISLSHSPTPSTIAGRLHHHYTTE*ATPWMVLSPVALLPSAEL 169 P + S +LP S SPT S + RLH + W SP L+P++ + Sbjct: 161 PTPTNSSTHLPA*SSSSPTVSVVHRRLHRPSPPPPSPLWTSSSPTQLIPTSAI 319
>LOC_Os08g14050:12008.t01281:unspliced-genomic expressed protein| Length = 3161 Score = 33.6 bits (67), Expect = 1.0 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 / +1 Query: 11 PESRSRSKNLPISLSHSPTPSTIAGRLHHHYTTE*ATPWMVLSPVALLPSAEL 169 P + S +LP S SPT S + RLH + W SP L+P++ + Sbjct: 847 PTPTNSSTHLPA*SSSSPTVSAVHRRLHRPSPPPPSPLWTSSSPTQLIPTSAI 1005
>LOC_Os08g14030:12008.t004304:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass, expressed| Length = 8526 Score = 33.6 bits (67), Expect = 1.0 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 / -2 Query: 11 PESRSRSKNLPISLSHSPTPSTIAGRLHHHYTTE*ATPWMVLSPVALLPSAEL 169 P + S +LP S SPT S + RLH + W SP L+P++ + Sbjct: 5666 PTPTNSSTHLPA*SSSSPTVSAVHRRLHRPSPPPPSPLWTSSSPTQLIPTSAI 5508
>LOC_Os06g08154:12006.t00697:unspliced-genomic receptor-like protein kinase 5 precursor, putative, expressed| Length = 4674 Score = 33.1 bits (66), Expect = 1.4 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +3 / +3 Query: 87 ASITTTPPNRRRLGWFCHRWHCSP 158 A+ T TPP RR+L F RWH P Sbjct: 135 AASTATPPRRRQLLQFLPRWHRRP 206
>LOC_Os12g38090:12012.t03490:unspliced-genomic F-box domain containing protein| Length = 1398 Score = 32.7 bits (65), Expect = 1.9 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 / +2 Query: 188 SCSPRWLTPRWGAVPPVTKPSKAS 117 SC+ W TPR G+ P T PS AS Sbjct: 209 SCTRWWRTPRGGSPSPTTSPSIAS 280
>LOC_Os05g48700:12005.t04304:unspliced-genomic gibberellin 2-beta-dioxygenase, putative, expressed| Length = 2194 Score = 32.7 bits (65), Expect = 1.9 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 / -1 Query: 218 CQRGYSMSL*SCSPRWLTPRWGAVPPVTKPSKAS 117 C+RG S SC+P TP G+ PP P+ A+ Sbjct: 1609 CRRGASCRRPSCTPPR*TPCTGSAPPPASPAPAA 1508
>LOC_Os01g50160:12001.t04453:unspliced-genomic multidrug resistance protein 8, putative, expressed| Length = 6911 Score = 32.7 bits (65), Expect = 1.9 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 / -2 Query: 167 TPRWGAVPPVTKPSKASPIRWCSG 96 TPRW A PP PS A P R +G Sbjct: 232 TPRWRAPPPCRPPSAAGPCRRRTG 161
>LOC_Os01g70220:12001.t06323:unspliced-genomic histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6,| putative, expressed Length = 10209 Score = 32.7 bits (65), Expect = 1.9 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 / -2 Query: 29 SKNLPISLSHSPTPSTIAGRLHH 97 S N+PIS++H+P P T + LH+ Sbjct: 7139 STNIPISINHNPPPFTFSTYLHY 7071
>LOC_Os05g48170:12005.t04251:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3663 Score = 25.4 bits (49), Expect(2) = 2.6 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -3 / -3 Query: 167 TPRWGAVPPVTKPSKASPI 111 +PRW VPP + ++ P+ Sbjct: 2566 SPRWTLVPPASLAARVCPV 2510 Score = 24.0 bits (46), Expect(2) = 2.6 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / -3 Query: 218 CQRGYSMSL*SCSPRW 171 CQ+G CSPRW Sbjct: 2602 CQQGGQRESTCCSPRW 2555
>LOC_Os11g44650:12011.t03993:unspliced-genomic hypothetical protein| Length = 1272 Score = 32.2 bits (64), Expect = 2.6 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 / +3 Query: 249 R*LRRWKVRTPPCVWPAHHHGQAWYLV 329 R LR WK C W H GQ WY + Sbjct: 1032 RQLRMWKGERWRC*WRQQHAGQCWYFL 1112
>LOC_Os11g14360:12011.t01267:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 2034 Score = 32.2 bits (64), Expect = 2.6 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +3 / -1 Query: 258 RRWKVRTPPCVWPAHHHGQAWYLVHRWISLLIWNCSCSSV 377 ++W P VWP H H + W W S + C + Sbjct: 1383 QKWTGLGQPMVWPNHPHQRRWMQGLTWTSRIASQCRLEGI 1264
>LOC_Os07g01150:12007.t00015:unspliced-genomic C-4 methylsterol oxidase, putative, expressed| Length = 2426 Score = 32.2 bits (64), Expect = 2.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 / +2 Query: 246 HR*LRRWKVRTPPCVWPAHHHGQAWYL 326 H + R +R+PPC HHH W L Sbjct: 359 HLVIGRRSIRSPPCTRSTHHHPWPWAL 439
>LOC_Os04g01070:12004.t00007:unspliced-genomic formin Homology 2 Domain containing protein, expressed| Length = 4407 Score = 32.2 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 / -1 Query: 2 VLPPESRSRSKNLPISLSHSPTPSTIAGRLHH 97 +L P S S + PI+ SHSP P+ A +HH Sbjct: 1422 LLHPSSSSYHHHPPITPSHSPVPAIRAIMMHH 1327
>LOC_Os02g15050:12002.t01298:unspliced-genomic hypothetical protein| Length = 852 Score = 25.8 bits (50), Expect(2) = 2.9 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 / -1 Query: 151 APQRGVSHLGEHD 189 APQRGV H+G D Sbjct: 324 APQRGVEHVGVRD 286 Score = 23.5 bits (45), Expect(2) = 2.9 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +3 / -3 Query: 279 PPCVWPAHHHGQAWYLVHRWISLLIWNCSCSSV 377 PP WP H GQ + R + + C S V Sbjct: 166 PPRRWPRHRPGQRRARLRRRLPRVRHRCPGSKV 68
>LOC_Os04g16480:12004.t01407:unspliced-genomic hypothetical protein| Length = 399 Score = 26.7 bits (52), Expect(2) = 2.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 / -2 Query: 11 PESRSRSKNLPISLSHSPTPSTIAGRLHHH 100 PESRSR ++LP S P + R+ H Sbjct: 341 PESRSRRRSLPTPSPSSSGPPPSSPRITSH 252 Score = 22.1 bits (42), Expect(2) = 2.9 Identities = 5/6 (83%), Positives = 6/6 (100%) Frame = +3 / -2 Query: 279 PPCVWP 296 PPC+WP Sbjct: 32 PPCLWP 15
>LOC_Os07g32700:12007.t02952:unspliced-genomic conserved hypothetical protein| Length = 891 Score = 31.8 bits (63), Expect = 3.6 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +3 / +2 Query: 111 NRRRLGWFCHRW 146 +RRRLGW+C RW Sbjct: 809 HRRRLGWWCRRW 844
>LOC_Os01g39830:12001.t03509:unspliced-genomic beta-galactosidase precursor, putative, expressed| Length = 6044 Score = 25.4 bits (49), Expect(2) = 4.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 / -1 Query: 8 PPESRSRSKNLPISLSH 58 PP S + +K P+ LSH Sbjct: 4976 PPHSSNMTKRFPVGLSH 4926 Score = 23.1 bits (44), Expect(2) = 4.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 / -1 Query: 145 GTAPQRGVSHLGEHDYRDIE*PR*QSVT 228 G + +RG +L +HD R I R S T Sbjct: 4937 GLSHERGTWYLTDHDIRFIRASRVNSTT 4854
>LOC_Os08g44830:12008.t04206:unspliced-genomic zinc finger protein, putative, expressed| Length = 4153 Score = 25.4 bits (49), Expect(2) = 4.6 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = -2 / +3 Query: 399 SQLTSTLQHYYKNNSKSRERSTDVPNTRLDHGDEQAKRTEESEPSTVVA 253 ++L + HY + K +R ++ HGDE + S P+ ++A Sbjct: 3261 AELLAKYTHYCQVCGKGFKRDANLRMHMRAHGDEYKSKAALSNPTKLLA 3407 Score = 23.1 bits (44), Expect(2) = 4.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 / +1 Query: 188 SCSPRWLTPRW 156 SCSPR T RW Sbjct: 3397 SCSPREATRRW 3429
>LOC_Os12g16710:12012.t01524:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 6930 Score = 31.3 bits (62), Expect = 5.0 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 / +3 Query: 108 PNRRRLGWFCHRWHC 152 P R+ + WFC+R+HC Sbjct: 2031 P*RKYIAWFCYRYHC 2075
>LOC_Os12g07450:12012.t00629:unspliced-genomic nucleotide binding protein, putative, expressed| Length = 6495 Score = 31.3 bits (62), Expect = 5.0 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +3 / +2 Query: 279 PPCVWPAHHHGQAWYLVHRW 338 P CVW H G WY+ W Sbjct: 1034 PGCVWEQPHWGWPWYIRRHW 1093
>LOC_Os04g57930:12004.t05258:unspliced-genomic thioredoxin X, chloroplast precursor, putative, expressed| Length = 1769 Score = 31.3 bits (62), Expect = 5.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -3 / +2 Query: 179 PRWLTPRWGAVPPVTKPSKASPIRWC 102 PRW+ W PP + ASP R C Sbjct: 170 PRWVASAWWGPPPPHPAAAASPARAC 247
>LOC_Os04g52590:12004.t04733:unspliced-genomic protein kinase domain containing protein, expressed| Length = 7802 Score = 31.3 bits (62), Expect = 5.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 / +3 Query: 215 QRGYSMSL*SCSPRWLTPRWGAVPPVTKPSKAS 117 +RG S + + +PR T RW P T+PS A+ Sbjct: 303 RRGTSAATRAAAPRRTTRRWTTTRPSTRPSSAT 401
>LOC_Os01g72570:12001.t06545:unspliced-genomic expressed protein| Length = 9405 Score = 31.3 bits (62), Expect = 5.0 Identities = 8/20 (40%), Positives = 16/20 (80%) Frame = +3 / +1 Query: 324 LVHRWISLLIWNCSCSSVVK 383 L+HRW+ L++ C C+++V+ Sbjct: 9310 LMHRWVYLIVKACQCNTIVQ 9369
>LOC_Os01g20030:12001.t01791:unspliced-genomic expressed protein| Length = 738 Score = 31.3 bits (62), Expect = 5.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 / +2 Query: 188 SCSPRWLTPRWGAVPPVTKPSKASP 114 +CSPR TPRW T ASP Sbjct: 167 TCSPRSWTPRWATCRSTTSARPASP 241
>LOC_Os03g19760:12003.t01740:unspliced-genomic NHL repeat protein, putative, expressed| Length = 17828 Score = 31.3 bits (62), Expect = 5.0 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -1 / -2 Query: 190 SHAPLGG*LRAGEQCHR*QNHPRRRLFGGVVVM 92 S +P+ G L+A C R Q PRRRL V M Sbjct: 9508 SSSPVDGGLQACSGCSRRQQQPRRRLIPKAVAM 9410
>LOC_Os11g38060:12011.t03348:unspliced-genomic hydrolase, acting on ester bonds, putative, expressed| Length = 1057 Score = 24.9 bits (48), Expect(2) = 5.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 / +2 Query: 158 WGAVPPVTKPSKASP 114 WG P TKP SP Sbjct: 326 WGTTSPATKPGVPSP 370 Score = 23.5 bits (45), Expect(2) = 5.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 / +3 Query: 288 RTEESEPSTVVATDAPCRGG 229 R S PST T P RGG Sbjct: 273 RATRSRPSTSRCTATPTRGG 332
>LOC_Os07g07670:12007.t00645:unspliced-genomic expressed protein| Length = 1068 Score = 28.1 bits (55), Expect(2) = 6.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 / +3 Query: 255 LRRWKVRTPPCVWPA 299 L RW+ R PPC PA Sbjct: 534 LDRWRFRLPPCTLPA 578 Score = 22.1 bits (42), Expect(2) = 6.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 / +1 Query: 5 LPPESRSRSKNLPISLSHS 61 LPP RS + +L +SLS + Sbjct: 88 LPPNLRSPAPSLSLSLSRA 144
>LOC_Os02g37440:12002.t03382:unspliced-genomic conserved hypothetical protein| Length = 1893 Score = 25.4 bits (49), Expect(2) = 6.5 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 / +3 Query: 125 KASPIRWCSGDG 90 + PIRWC+G G Sbjct: 336 RRDPIRWCTGGG 371 Score = 22.6 bits (43), Expect(2) = 6.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 / +1 Query: 282 EESEPSTVVATDAPCRGGR 226 E + PS+ APC GGR Sbjct: 256 EGAAPSSSPPAAAPCGGGR 312
>LOC_Os12g01850:12012.t00083:unspliced-genomic vegetative storage protein, putative, expressed| Length = 3279 Score = 25.8 bits (50), Expect(2) = 6.6 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 / -3 Query: 283 GGVRTFHRRSYRCPLSWRS 227 G +++FH +S + P SWRS Sbjct: 1981 G*MQSFHGQSCQAPRSWRS 1925 Score = 25.8 bits (50), Expect(2) = 6.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 / -3 Query: 179 PRWLTPRWGAVPPVTKPSKASP 114 P+W R PP +PSK SP Sbjct: 1537 PQWPRTRSVQSPPARQPSKQSP 1472
>LOC_Os04g28570:12004.t02553:unspliced-genomic fatty acyl coA reductase, putative| Length = 1669 Score = 26.7 bits (52), Expect(2) = 6.6 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 / -1 Query: 129 WFCHRWHCSP 158 WF H+WH SP Sbjct: 1639 WFLHQWHQSP 1610 Score = 24.0 bits (46), Expect(2) = 6.6 Identities = 5/14 (35%), Positives = 10/14 (71%) Frame = +3 / -1 Query: 318 WYLVHRWISLLIWN 359 W + +W+ L++WN Sbjct: 1024 WNI*EKWLCLILWN 983
>LOC_Os11g09650:12011.t00857:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1340 Score = 30.9 bits (61), Expect = 6.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -3 / -3 Query: 212 RGYSMSL*SCSPRWLTPRWGAVPPVTKPSKASP 114 RG S CSP L+PR G PV+ P +P Sbjct: 309 RGASGPRVMCSPSSLSPRGGRTAPVSAPRAGAP 211
>LOC_Os08g22030:12008.t01991:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5245 Score = 30.9 bits (61), Expect = 6.8 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 / -2 Query: 261 RWKVRTPPCVWPAHHHGQAWYLVHRWI 341 RW R CV AHH G A L H+ I Sbjct: 120 RWNGRVLRCVGVAHHQGHASQLSHKII 40
>LOC_Os04g51404:12004.t05477:unspliced-genomic expressed protein| Length = 2082 Score = 30.9 bits (61), Expect = 6.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 / +3 Query: 437 EHKSREISTGIQNPS*HQLYNTTTRTIPNQERD 339 +HK R + QN S + NT TRT P+ +RD Sbjct: 387 DHKHRPPNRSSQNNSRAKTTNTITRTRPSDDRD 485
>LOC_Os04g51400:12004.t04617:unspliced-genomic zinc finger, C3HC4 type family protein, expressed| Length = 3386 Score = 30.9 bits (61), Expect = 6.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 / -2 Query: 437 EHKSREISTGIQNPS*HQLYNTTTRTIPNQERD 339 +HK R + QN S + NT TRT P+ +RD Sbjct: 334 DHKHRPPNRSSQNNSRAKTTNTITRTRPSDDRD 236
>LOC_Os04g12090:12004.t01033:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass, expressed| Length = 2947 Score = 30.9 bits (61), Expect = 6.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 / -2 Query: 164 PRWGAVPPVTKPSKASPIRWCSGDGG 87 PRW PP + +++ I+WC+ G Sbjct: 756 PRWSTTPPCSGWTRSRQIQWCTSRWG 679
>LOC_Os03g20680:12003.t01824:unspliced-genomic embryonic protein DC-8, putative, expressed| Length = 1411 Score = 30.9 bits (61), Expect = 6.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 / +1 Query: 182 SPRWLTPRWGAVPPVTKPSKASPIRWC 102 +P PRW PP T P+ A+ R C Sbjct: 238 APTAAPPRWAPTPPTTPPAAAASWRAC 318
>LOC_Os11g01860:12011.t00083:unspliced-genomic pentatricopeptide repeat protein PPR1106-17, putative, expressed| Length = 2438 Score = 28.1 bits (55), Expect(2) = 6.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 / +2 Query: 336 WISLLIWNCSCSSVVKLMLAGILNT 410 WI++L+W C S + M A +L++ Sbjct: 377 WIAILLWGALCCSCTQSMAALLLHS 451 Score = 23.1 bits (44), Expect(2) = 6.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 / +2 Query: 8 PPESRSRSKNLPISLSHSPTPST 76 PP S P+S + S TPST Sbjct: 11 PPPPLHTSTRTPLSWARSLTPST 79
>LOC_Os09g29570:12009.t02635:unspliced-genomic hypothetical protein| Length = 2564 Score = 30.9 bits (61), Expect = 6.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 / -2 Query: 8 PPESRSRSKNLPISLSHSPTPSTIAGRLHHHYTTE 112 PP +R S+ P+S S +PT + + R H + E Sbjct: 1021 PPTARPTSRKNPLSSSDAPTATAASNRRHRRSSQE 917
>LOC_Os04g44620:12004.t04002:unspliced-genomic hus1-like protein, expressed| Length = 6954 Score = 30.9 bits (61), Expect = 6.9 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 / -3 Query: 383 VDVSWDFEYRWISLLIYVLV 442 +++S DF Y W+ LLIY+LV Sbjct: 5290 INMSRDFGYYWLRLLIYLLV 5231
>LOC_Os04g44610:12004.t04001:unspliced-genomic ABC transporter C05D10.3 in chromosome III, putative, expressed| Length = 5751 Score = 30.9 bits (61), Expect = 6.9 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 / +3 Query: 383 VDVSWDFEYRWISLLIYVLV 442 +++S DF Y W+ LLIY+LV Sbjct: 3510 INMSRDFGYYWLRLLIYLLV 3569
>LOC_Os04g33210:12004.t02997:unspliced-genomic ERD1 protein, chloroplast precursor, putative, expressed| Length = 5549 Score = 30.9 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 / +2 Query: 62 PTPSTIAGRLHHHYTTE*ATPWMVLSPVALLPSAE 166 P+PS +A RLH H ++ TP +L+P +P E Sbjct: 122 PSPSFLACRLHFHCSSIHPTPHHLLTPDYSIPFRE 226
>LOC_Os01g63810:12001.t05749:unspliced-genomic starch binding domain containing protein, expressed| Length = 2644 Score = 30.9 bits (61), Expect = 6.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 / +1 Query: 230 PPRQGASVATTVEGSDSSVRLACSSPW 310 PPR G ++ GS SS R C PW Sbjct: 247 PPRDGGRCSSRRSGSPSSRRNPCRRPW 327
>LOC_Os01g25460:12001.t02262:unspliced-genomic extensin-like protein, putative, expressed| Length = 1844 Score = 23.5 bits (45), Expect(3) = 7.3 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 / +2 Query: 8 PPESRSRSKNLPISLSHSPTPSTIA 82 PP SR+ S P S SPT ++ A Sbjct: 758 PPASRTPSAGPPRRSSSSPTTTSAA 832 Score = 22.6 bits (43), Expect(3) = 7.3 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 / +2 Query: 303 HHGQAWYLVHRWISL 347 HH WY HR SL Sbjct: 1376 HHRHRWYPRHRQCSL 1420 Score = 21.7 bits (41), Expect(3) = 7.3 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 / +1 Query: 273 RTPPCVWPA 299 +T PC WPA Sbjct: 1270 KTKPCGWPA 1296
>LOC_Os02g53850:12002.t04964:unspliced-genomic xylem serine proteinase 1 precursor, putative, expressed| Length = 2347 Score = 25.4 bits (49), Expect(2) = 8.9 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +3 / -2 Query: 129 WFCHRWHC 152 W C RWHC Sbjct: 1797 WPCQRWHC 1774 Score = 25.4 bits (49), Expect(2) = 8.9 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +3 / -2 Query: 258 RRWKVRTPPCVWPAHHHGQAWYLVHRWISLLIWNCSC 368 RR V PC W H GQ + + L C C Sbjct: 795 RRRCVHREPCPWQRHWQGQRGWHPTQESQLQWQRCGC 685
>LOC_Os12g44160:12012.t04082:unspliced-genomic oxidoreductase, putative, expressed| Length = 3989 Score = 30.4 bits (60), Expect = 9.4 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +3 / +1 Query: 324 LVHRWISLLIWNCSCSSVVKLMLAGILNTGGYLS*FMFLYLI 449 L+H ++LL+ C S +KL + L + GYLS F+ L+ Sbjct: 1189 LLHNLVTLLLLQCPAFSHLKLQTSDWLTSLGYLSMNTFVALM 1314
>LOC_Os09g35780:12009.t03056:unspliced-genomic BAP2, putative, expressed| Length = 814 Score = 30.4 bits (60), Expect = 9.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 / +3 Query: 87 ASITTTPPNRRRLGWFCHR 143 A+ T TP RRR GW C R Sbjct: 405 ATATGTPTGRRRCGWRCRR 461
>LOC_Os07g13940:12007.t01258:unspliced-genomic cytokinin-N-glucosyltransferase 1, putative, expressed| Length = 1476 Score = 30.4 bits (60), Expect = 9.4 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 / +2 Query: 182 SPRWLTPRWGAVPPVTKPSKASPIRWCSGDGG 87 +P W + W + PP + S WC GG Sbjct: 221 APTWSSRCWRSTPPARRRSARRSGGWCGSGGG 316
>LOC_Os04g32920:12004.t02970:unspliced-genomic potassium transporter 1, putative, expressed| Length = 5819 Score = 30.4 bits (60), Expect = 9.4 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = +3 / +1 Query: 171 PPRGA*L*RHRVTSLTKCYDLHDKGHR*LRRWKVRTPPCVWPAHHHGQAWYLVHRWISLL 350 P RG L RHR + + HR RR + R P HHH A +HR + Sbjct: 1750 PERGHHLRRHRHVAAVRLLQHVPGRHRPPRRPRRRPLPHPLHPHHHPHAQVRLHRPLRQR 1929 Query: 351 IW 356 W Sbjct: 1930 QW 1935
>LOC_Os04g13340:12004.t01155:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1071 Score = 30.4 bits (60), Expect = 9.4 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +3 / +3 Query: 279 PPCVWPAHHHGQAWYLVHR 335 P C WP H WY HR Sbjct: 357 PRCWWPVLRHQDLWYCYHR 413
>LOC_Os03g11350:12003.t00935:unspliced-genomic cytokinin-O-glucosyltransferase 3, putative, expressed| Length = 1590 Score = 30.4 bits (60), Expect = 9.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 / +2 Query: 185 CSPRWLTPRWGAVPPVTKPSKASPIRW 105 C+P WLT R G + ++A+P RW Sbjct: 1313 CAPPWLTRRCGGGRRRSASARAAPSRW 1393
>LOC_Os02g52610:12002.t04842:unspliced-genomic galactoside 2-alpha-L-fucosyltransferase, putative, expressed| Length = 8077 Score = 30.4 bits (60), Expect = 9.4 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +3 / +3 Query: 171 PPRGA*L*RHRVTSLTKCYDLHDKGHR*LRRWKVRTPPCVWPAH 302 PP RHR T+ T C + R R W +PP + AH Sbjct: 1983 PPSSPHSRRHRCTAATNCRRPPSRSGREARIWGTPSPPSLPQAH 2114
>LOC_Os02g01210:12002.t00021:unspliced-genomic amino acid transporter, putative, expressed| Length = 2312 Score = 30.4 bits (60), Expect = 9.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 / +2 Query: 99 TTPPNRRRLGWFCHRWHCSPARS*PP 176 T+ P RRR G C RW SP+ + P Sbjct: 1406 TSSPPRRRCGATCRRWGTSPSPTPTP 1483
>LOC_Os01g70240:12001.t06325:unspliced-genomic expressed protein| Length = 3243 Score = 30.4 bits (60), Expect = 9.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 / -2 Query: 315 AWYLVHRWISLLIWNCSC 368 AW L H W+ L++W SC Sbjct: 146 AWSLHHSWLHLILW*SSC 93
>LOC_Os01g56764:12001.t05086:unspliced-genomic expressed protein| Length = 10263 Score = 30.4 bits (60), Expect = 9.4 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 / -1 Query: 108 PNRRRLGWFCHRWHCSPARS 167 P+RRR W C W C RS Sbjct: 9387 PSRRRWCWCCRGWRCRRGRS 9328
>LOC_Os01g08810:12001.t00759:unspliced-genomic cytochrome P450 86A1, putative, expressed| Length = 1790 Score = 30.4 bits (60), Expect = 9.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 / -2 Query: 243 GHR*LRRWKVRTPPCVWPA 299 G R* RRW R PP WP+ Sbjct: 856 GER*ARRWTRRAPPEPWPS 800
>LOC_Os10g42900:12010.t03513:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 2958 Score = 30.4 bits (60), Expect = 9.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 / -1 Query: 23 SRSKNLPISLSHSPTPSTIAGRLHHH 100 +RS +L + SH+P PST+ L H Sbjct: 1311 TRSTSLTVHTSHTPPPSTLTAALSSH 1234
>LOC_Os08g09610:12008.t00846:unspliced-genomic expressed protein| Length = 1177 Score = 30.4 bits (60), Expect = 9.5 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -2 / -1 Query: 312 DHGDEQAKRTEESEPSTVVATDAPCRGGRNTLSAR 208 DH + K T ++PS T PC T +AR Sbjct: 487 DHSRHRGKETTSNKPSRRAPTAPPCAAAMTTAAAR 383
>LOC_Os04g32260:12004.t02905:unspliced-genomic conserved hypothetical protein| Length = 3141 Score = 30.4 bits (60), Expect = 9.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 / -3 Query: 83 GRLHHHYTTE*ATPWMVL 136 G LHHHY * +PW+ L Sbjct: 1540 GHLHHHYHRP*PSPWLPL 1487
>LOC_Os03g64030:12003.t05618:unspliced-genomic receptor protein kinase-like protein, putative, expressed| Length = 1771 Score = 30.4 bits (60), Expect = 9.5 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 / +3 Query: 184 APLGG*LRAGEQCHR*QNHPRRR 116 AP+GG RA Q HR Q H RRR Sbjct: 273 APMGGGPRAAPQRHRLQPHLRRR 341
>LOC_Os02g21770:12002.t01966:unspliced-genomic hypothetical protein| Length = 511 Score = 30.4 bits (60), Expect = 9.5 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +2 / -2 Query: 8 PPESRSRSKNLPISLSHSPTPSTIAGR 88 PP S SRS L +SLSHSP + A R Sbjct: 186 PPLSLSRSSLLSLSLSHSPDVAPPARR 106
>LOC_Os01g46450:12001.t04096:unspliced-genomic conserved hypothetical protein| Length = 1087 Score = 30.4 bits (60), Expect = 9.5 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 / -1 Query: 360 NSKSRERSTDVPNTRLDHGDEQAKRTEE 277 +S S+ S +V NTRL HG Q+K ++ Sbjct: 499 SSNSKTDSREVRNTRLQHGTSQSKNRKK 416 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 218,363,088 Number of extensions: 3966780 Number of successful extensions: 19996 Number of sequences better than 10.0: 66 Length of query: 174 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 126 Effective length of database: 52,912,542 Effective search space: 6666980292 Effective search space used: 6666980292 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)