| Clone Name | FLbaf172k23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q80TZ9:RERE_MOUSE Arginine-glutamic acid dipeptide repeats prote... | 37 | 0.75 | 2 | P24892:NU4M_CAEEL NADH-ubiquinone oxidoreductase chain 4 - Caeno... | 34 | 3.7 | 3 | Q9P2R6:RERE_HUMAN Arginine-glutamic acid dipeptide repeats prote... | 33 | 6.4 |
|---|
>Q80TZ9:RERE_MOUSE Arginine-glutamic acid dipeptide repeats protein - Mus musculus| (Mouse) Length = 1558 Score = 36.6 bits (83), Expect = 0.75 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = +2 Query: 35 PFAS*LTNHSAAMFSPPAQ--PRFDPLRPTSPTS*PFIAPSCYLRQRRQVRPPAATHPMR 208 P +S T+H + PP Q P+ PL P+SP P L Q + + PPAA+HP Sbjct: 963 PLSSLSTHHPPSAHPPPLQLMPQSQPL-PSSPAQPPG------LTQSQSLPPPAASHPTT 1015 Query: 209 PLVQFAGASP 238 L Q SP Sbjct: 1016 GLHQVPSQSP 1025
>P24892:NU4M_CAEEL NADH-ubiquinone oxidoreductase chain 4 - Caenorhabditis elegans| Length = 409 Score = 34.3 bits (77), Expect = 3.7 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +2 Query: 1844 SMRTRSISSGLMQALGWLITILVTLLGLRQHTGGTKSIYPLSYFQVSIIMCSLLFLAV 2017 +M ++ S LM A G+ T++ L+G HT G++ IY +S F S ++ +LF V Sbjct: 266 TMSSKISSVMLMLAHGYTSTLMFYLIGEFYHTSGSRMIYFMSSFFSSSMIMGILFSVV 323
>Q9P2R6:RERE_HUMAN Arginine-glutamic acid dipeptide repeats protein - Homo sapiens| (Human) Length = 1566 Score = 33.5 bits (75), Expect = 6.4 Identities = 25/70 (35%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Frame = +2 Query: 35 PFAS*LTNHSAAMFSPPAQ--PRFDPLRPTSPTS*PFIAPSCYLRQRRQVRPPAATHPMR 208 P +S T+H + PP Q P+ PL P+SP P L Q + + PP A+HP Sbjct: 971 PLSSLSTHHPPSAHPPPLQLMPQSQPL-PSSPAQPPG------LTQSQNLPPPPASHPPT 1023 Query: 209 PLVQFAGASP 238 L Q A P Sbjct: 1024 GLHQVAPQPP 1033 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 641,789,753 Number of extensions: 14635564 Number of successful extensions: 40964 Number of sequences better than 10.0: 3 Number of HSP's gapped: 40891 Number of HSP's successfully gapped: 3 Length of query: 1169 Length of database: 100,686,439 Length adjustment: 124 Effective length of query: 1045 Effective length of database: 66,673,859 Effective search space: 69674182655 Effective search space used: 69674182655 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)