| Clone Name | FLbaf166d19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | O75964:ATP5L_HUMAN ATP synthase subunit g, mitochondrial - Homo ... | 31 | 7.0 |
|---|
>O75964:ATP5L_HUMAN ATP synthase subunit g, mitochondrial - Homo sapiens (Human)| Length = 103 Score = 30.8 bits (68), Expect = 7.0 Identities = 25/100 (25%), Positives = 43/100 (43%), Gaps = 5/100 (5%) Frame = +2 Query: 242 KTLMEKNKQFVVQPPTVEKCQELSKQLFYTRIASIPGRCEAFWKEVDQVKQLWRNRS--- 412 + L+EK V T K L+ +Y ++ +P + + +K++ + Sbjct: 6 RNLVEKTPALVNAAVTYSK-PRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGS 64 Query: 413 --DLNVEHAGIAALFGLELYGWFCVGEIAGRGFTLTGYSV 526 L V+ A + L E+ WF VGEI G+ + GY V Sbjct: 65 FKQLTVKEAVLNGLVATEVLMWFYVGEIIGKR-GIIGYDV 103 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 126,146,424 Number of extensions: 2443184 Number of successful extensions: 6580 Number of sequences better than 10.0: 1 Number of HSP's gapped: 6578 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 169 Effective length of database: 69,965,399 Effective search space: 11824152431 Effective search space used: 11824152431 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)