| Clone Name | FLbaf170o02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P25578:PGS1_YEAST CDP-diacylglycerol--glycerol-3-phosphate 3-pho... | 33 | 4.5 |
|---|
>P25578:PGS1_YEAST CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase| - Saccharomyces cerevisiae (Baker's yeast) Length = 521 Score = 33.1 bits (74), Expect = 4.5 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 538 QVVQYARPHMRIISLPTQLPFCSVRRQTSRKHGSFDRQTGTI 413 +++Q RPH R++SLP Q PF R+ ++ F TI Sbjct: 4 RLLQLTRPHYRLLSLPLQKPFNIKRQMSAANPSPFGNYLNTI 45 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 351,558,104 Number of extensions: 7607573 Number of successful extensions: 16075 Number of sequences better than 10.0: 1 Number of HSP's gapped: 16072 Number of HSP's successfully gapped: 1 Length of query: 673 Length of database: 100,686,439 Length adjustment: 120 Effective length of query: 553 Effective length of database: 67,771,039 Effective search space: 37477384567 Effective search space used: 37477384567 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)