| Clone Name | FLbaf160c05 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os06g48500:12006.t04536:unspliced-genomic expressed protein| Length = 2104 Score = 57.0 bits (118), Expect(4) = 4e-19 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 / +3 Query: 316 KRGLSSFFSGKSRSFANLQDVAVAGTTSS 402 +RGLS+FFSGKSRSFANLQDVA AG T++ Sbjct: 1086 RRGLSNFFSGKSRSFANLQDVAAAGATTA 1172 Score = 49.2 bits (101), Expect(4) = 4e-19 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +1 / +3 Query: 382 VAGTTSSKDVLAKPENPFNKXXXXXXXXXXXXXXXTSLTALPPFQPP 522 VA ++ LAKPENPFNK TSLTALPPF PP Sbjct: 1146 VAAAGATTASLAKPENPFNKRRRILRCSSIRRVSSTSLTALPPFLPP 1286 Score = 28.6 bits (56), Expect(4) = 4e-19 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 / +1 Query: 1 GGGARKRKDVV 33 GGGARKRKDVV Sbjct: 664 GGGARKRKDVV 696 Score = 24.0 bits (46), Expect(4) = 4e-19 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 / +1 Query: 751 WMDGWIPLCNSPGSRSSRLTSTTMAA*SLGF 843 W+ P CNS GS + T * LGF Sbjct: 1423 WIIWMDPFCNSLGSHLIKSTIKNTLY*CLGF 1515 Score = 53.3 bits (110), Expect(2) = 3e-07 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -1 / -1 Query: 404 LLLVVPATATSCRFANDRDLPEKKLDRPRL 315 L +V PA ATSCR AND DLPEKKLD P L Sbjct: 1174 LAVVAPAAATSCRLANDLDLPEKKLDSPLL 1085 Score = 25.8 bits (50), Expect(2) = 3e-07 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -3 / -2 Query: 141 LFLHRLQHEQPV 106 L L RLQHEQPV Sbjct: 807 LLLDRLQHEQPV 772 Score = 43.2 bits (88), Expect(2) = 6e-05 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -3 / -3 Query: 396 GGAGDRHVLQVRERPRLAGEEARQAP 319 G AG HVLQV ERPRLAGEE Q P Sbjct: 1166 GCAGGGHVLQVGERPRLAGEEVGQPP 1089 Score = 23.5 bits (45), Expect(2) = 6e-05 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 / -1 Query: 440 LLKGFSGLASTSLLLVVPATA 378 LL GFSGLA +++ AT+ Sbjct: 1204 LLNGFSGLARLAVVAPAAATS 1142 Score = 25.4 bits (49), Expect(2) = 2.3 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +3 / +2 Query: 330 ELLLRQVAVVREP 368 +LLLRQV VVR+P Sbjct: 1100 QLLLRQVEVVRQP 1138 Score = 25.4 bits (49), Expect(2) = 2.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 / +1 Query: 365 TCRTWRSPAPP 397 TCRTW PA P Sbjct: 1135 TCRTWPPPAQP 1167
>LOC_Os08g40510:12008.t03781:unspliced-genomic KID-containing protein, putative, expressed| Length = 1764 Score = 34.5 bits (69), Expect(2) = 5e-04 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = +1 / +1 Query: 316 KRGLSSFFSGKSRSFANLQDVA 381 +RGLS+F++GKS+SF +L + A Sbjct: 1093 RRGLSNFYAGKSKSFTSLAEAA 1158 Score = 29.0 bits (57), Expect(2) = 5e-04 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 / +1 Query: 376 VAVAGTTSSKDVLAKPENPFNK 441 +A A ++ +AKPENPFNK Sbjct: 1144 LAEAAAKAAAKEIAKPENPFNK 1209
>LOC_Os07g31884:12007.t02873:unspliced-genomic transparent testa 12 protein, putative, expressed| Length = 6914 Score = 31.3 bits (62), Expect(2) = 0.003 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 / +1 Query: 716 TLLGRRETRWMDGWMDG 766 T+ RWMDGWMDG Sbjct: 3544 TMSSGGHVRWMDGWMDG 3594 Score = 29.5 bits (58), Expect(2) = 0.003 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 / +1 Query: 742 MDGWMDGWIPLCNSPGSRSS 801 MDGWMDGW+ + +SS Sbjct: 3574 MDGWMDGWMDVKRRARPQSS 3633 Score = 33.1 bits (66), Expect = 3.1 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 / +3 Query: 742 MDGWMDGWIPLCNSPG 789 MDGWMDGW+ C G Sbjct: 3570 MDGWMDGWMDGCKETG 3617 Score = 32.2 bits (64), Expect = 5.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 / +2 Query: 732 ERQDGWMDGWMDPTL**SG 788 + DGWMDGWMD +* G Sbjct: 3560 DTSDGWMDGWMDGWM*RDG 3616
>LOC_Os07g02810:12007.t00172:unspliced-genomic L-ascorbate oxidase homolog precursor, putative, expressed| Length = 2992 Score = 35.0 bits (70), Expect(2) = 0.011 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 / -3 Query: 679 CMQVAKGISNGNYSTREERDKMDGWMDGW 765 C + I+ G S ++ ++DGWMDGW Sbjct: 266 CAVLVHKITTGKQSKEKQNLRVDGWMDGW 180 Score = 24.0 bits (46), Expect(2) = 0.011 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 / -2 Query: 751 WMDGWIPLCNSPG 789 WMDGW+ N+ G Sbjct: 198 WMDGWMEKKNASG 160
>LOC_Os03g42569:12003.t03660:unspliced-genomic expressed protein| Length = 10430 Score = 29.9 bits (59), Expect(2) = 0.080 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 / -3 Query: 748 GWMDGWIPLCNSPGSRSSRLTSTTMAA 828 GWMDGW+ + + G RS + + AA Sbjct: 5883 GWMDGWMEM*SIAGRRSKQAS*AAAAA 5803 Score = 25.8 bits (50), Expect(2) = 0.080 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 / -2 Query: 683 CKLQRELVMETTLLGRRETRWMDGWMDGS 769 C R L R + MDGWMDG+ Sbjct: 5944 CAN*RSLCAWQAFWAARSRQGMDGWMDGN 5858
>LOC_Os01g38980:12001.t03431:unspliced-genomic calmodulin binding protein, putative, expressed| Length = 3260 Score = 38.2 bits (77), Expect = 0.095 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +3 / -3 Query: 720 Y*GGERQDGWMDGWMD 767 Y GG R DGWMDGWMD Sbjct: 180 YIGGGRIDGWMDGWMD 133 Score = 36.3 bits (73), Expect = 0.34 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 / -2 Query: 704 VMETTLLGRRETRWMDGWMDG 766 V+ + + RR+ RWMDGWMDG Sbjct: 196 VVGSPIYRRRKDRWMDGWMDG 134 Score = 32.7 bits (65), Expect = 4.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 / -1 Query: 741 DGWMDGWMDPTL 776 DGWMDGWMD +L Sbjct: 155 DGWMDGWMDGSL 120
>LOC_Os02g53370:12002.t04916:unspliced-genomic hypothetical protein| Length = 1044 Score = 31.3 bits (62), Expect(2) = 0.23 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 / +2 Query: 731 RETRWMDGWMDG 766 R RWMDGWMDG Sbjct: 17 RLQRWMDGWMDG 52 Score = 23.1 bits (44), Expect(2) = 0.23 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +1 / +1 Query: 751 WMDGWIPLCNSP 786 W DG++ CN+P Sbjct: 58 WWDGFVFACNTP 93
>LOC_Os02g45930:12002.t04180:unspliced-genomic expressed protein| Length = 1222 Score = 35.9 bits (72), Expect = 0.47 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = +1 / +1 Query: 316 KRGLSSFFSGKSRSFANLQDVA 381 +RGLS FF GKS+SFA+L VA Sbjct: 559 RRGLSRFFDGKSQSFASLAAVA 624
>LOC_Os02g57350:12002.t05307:unspliced-genomic expressed protein| Length = 1204 Score = 29.0 bits (57), Expect(2) = 0.55 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 / -2 Query: 751 WMDGWIPLCNSPGSRSSRLTSTTMAA 828 WMDGWIP + SS + M A Sbjct: 120 WMDGWIPFSQVRSTSSSCSAAVAMEA 43 Score = 24.0 bits (46), Expect(2) = 0.55 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 / -3 Query: 746 MDGWMDGS 769 +DGWMDGS Sbjct: 125 LDGWMDGS 102
>LOC_Os06g25550:12006.t02362:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4209 Score = 29.9 bits (59), Expect(2) = 0.68 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -3 / -1 Query: 759 IHPSIHLVSLLPSRVVSITNSLCNLHA*ICMCFSLFDRSINLISS 625 I PSI+ VS L R + + LCN H+ +C L R ++L S Sbjct: 1269 ISPSIYEVSCLLIRPLFSLS*LCNAHSPLCAVEVLKKRILHLFPS 1135 Score = 22.6 bits (43), Expect(2) = 0.68 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 / -1 Query: 931 STTHAPCLVLSLPLFACQ 878 +T+H C+VL + F CQ Sbjct: 1443 ATSHELCVVLYICSFRCQ 1390
>LOC_Os06g46380:12006.t04324:unspliced-genomic rab geranylgeranyl transferase like protein, putative, expressed| Length = 4513 Score = 35.0 bits (70), Expect = 0.88 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 / -3 Query: 736 DKMDGWMDGWIPLCNSPG 789 +K DGWMDGW+ C S G Sbjct: 347 EKEDGWMDGWMLTCGSGG 294 Score = 32.7 bits (65), Expect = 4.3 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +3 / -3 Query: 732 ERQDGWMDGWM 764 E++DGWMDGWM Sbjct: 347 EKEDGWMDGWM 315
>LOC_Os09g32330:12009.t02848:unspliced-genomic MTD1, putative, expressed| Length = 2129 Score = 34.5 bits (69), Expect = 1.2 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = +1 / +2 Query: 316 KRGLSSFFSGKSRSFANLQDVAVAGTTSSKDV 411 +RGLS+F++GKS+SF +L + + ++ ++ Sbjct: 1349 RRGLSNFYAGKSKSFTSLAEATASPAAAANEL 1444
>LOC_Os04g49370:12004.t04453:unspliced-genomic expressed protein| Length = 1560 Score = 34.5 bits (69), Expect = 1.2 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 / +1 Query: 316 KRGLSSFFSGKSRSFANLQDV 378 +RGLS FF GKS+SFA+L V Sbjct: 520 RRGLSKFFDGKSQSFASLAAV 582
>LOC_Os03g57050:12003.t04974:unspliced-genomic expressed protein| Length = 1651 Score = 34.5 bits (69), Expect = 1.2 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +2 / +2 Query: 374 TWRSPAPPAARTCWPSR 424 T SPAPPAA +CWP R Sbjct: 257 TASSPAPPAATSCWPRR 307 Score = 33.6 bits (67), Expect = 2.3 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -3 / -2 Query: 432 GVLRLGQHVLAAGGAGDRHV 373 G RLGQH +AAGGAGD V Sbjct: 315 GGARLGQHEVAAGGAGDEAV 256
>LOC_Os03g49990:12003.t04345:unspliced-genomic DELLA protein SLR1, putative, expressed| Length = 2555 Score = 34.5 bits (69), Expect = 1.2 Identities = 18/37 (48%), Positives = 20/37 (54%) Frame = -3 / +3 Query: 429 VLRLGQHVLAAGGAGDRHVLQVRERPRLAGEEARQAP 319 V+R G+ AG AGD H RERPR G R AP Sbjct: 396 VVRHGRRRAEAGAAGDGHGDGRRERPRRRG*RVRVAP 506
>LOC_Os02g05840:12002.t00482:unspliced-genomic expressed protein| Length = 5625 Score = 27.2 bits (53), Expect(2) = 1.2 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 / +3 Query: 751 WMDGWIPLC 777 WMDGW+ LC Sbjct: 462 WMDGWVRLC 488 Score = 24.4 bits (47), Expect(2) = 1.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 700 ISNGNYSTREERDKMDGWMDG 762 + G S R + D + GWMDG Sbjct: 415 LGGGWCSVRRDLDFLCGWMDG 477
>LOC_Os04g33210:12004.t02997:unspliced-genomic ERD1 protein, chloroplast precursor, putative, expressed| Length = 5549 Score = 34.1 bits (68), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 / -2 Query: 374 TWRSPAPPAARTCWPSRR 427 +WR+P P R CWP RR Sbjct: 871 SWRTPRRPRRRACWPPRR 818
>LOC_Os01g72990:12001.t06583:unspliced-genomic ATP binding protein, putative, expressed| Length = 13183 Score = 26.7 bits (52), Expect(2) = 2.0 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 / +3 Query: 751 WMDGWIPLCNSPGSRSSRLTST 816 WMDGW SP S + T+T Sbjct: 351 WMDGWRGALPSPPSPNPEFTTT 416 Score = 24.0 bits (46), Expect(2) = 2.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 / +1 Query: 719 LLGRRETRWMDGWMDG 766 LL R +DGWMDG Sbjct: 319 LLRSEGDRLVDGWMDG 366
>LOC_Os09g34960:12009.t03023:unspliced-genomic hydroxymethylglutaryl-CoA synthase, putative, expressed| Length = 4037 Score = 33.6 bits (67), Expect = 2.3 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 / +1 Query: 738 QDGWMDGWMD 767 QDGWMDGWMD Sbjct: 694 QDGWMDGWMD 723
>LOC_Os04g14150:12004.t01234:unspliced-genomic early response to drought 3, putative, expressed| Length = 2234 Score = 33.6 bits (67), Expect = 2.3 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 / +3 Query: 371 RTWRSPAPPAARTCWPS 421 R+WRS PP+ R+ WPS Sbjct: 909 RSWRSTPPPSGRSAWPS 959
>LOC_Os07g40000:12007.t03661:unspliced-genomic seed specific protein Bn15D17A, putative, expressed| Length = 1051 Score = 33.1 bits (66), Expect = 3.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 / +1 Query: 368 CRTWRSPAPPAARTCWPSRR 427 CRT +P PP A TC P RR Sbjct: 463 CRTRSTPPPPVAATCSPPRR 522
>LOC_Os03g44780:12003.t03863:unspliced-genomic GTP binding protein, putative, expressed| Length = 3357 Score = 33.1 bits (66), Expect = 3.1 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +2 / +2 Query: 893 REREHQTWCMCRRS*P 940 RE+ HQ WCMCRR P Sbjct: 1325 REQMHQWWCMCRRCLP 1372
>LOC_Os09g36470:12009.t03123:unspliced-genomic minus agglutinin, putative, expressed| Length = 3738 Score = 31.8 bits (63), Expect(2) = 4.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 / +1 Query: 707 LLIPFATCMHKYACVFLFSIGRSI*SHRCT 618 L+I +ATC H ++C L S S +H C+ Sbjct: 2164 LVI*YATCAHYFSCTALTSTSSSCAAHACS 2253 Score = 23.1 bits (44), Expect(2) = 4.2 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -3 / +2 Query: 417 GQHVLAAGGAGDRHVLQVRERPRLAGEEARQA 322 G AGG DR L+ RER + ++++ A Sbjct: 3113 GPMFAVAGGGRDRVELEARERRKNRMDKSKTA 3208
>LOC_Os07g29060:12007.t02596:unspliced-genomic hypothetical protein| Length = 2237 Score = 32.7 bits (65), Expect = 4.3 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +3 / +2 Query: 735 RQDGWMDGWMD 767 R DGWMDGWMD Sbjct: 1808 RLDGWMDGWMD 1840
>LOC_Os06g08460:12006.t00725:unspliced-genomic exo70 exocyst complex subunit family protein, expressed| Length = 1547 Score = 32.7 bits (65), Expect = 4.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 / -3 Query: 368 CRTWRSPAPPAARTCWPSRR 427 CRT R P P +R CW RR Sbjct: 189 CRTGRRPTPGCSRRCWNRRR 130
>LOC_Os05g34260:12005.t03020:unspliced-genomic transposon protein, putative, Ac/Ds sub-class, expressed| Length = 4866 Score = 32.7 bits (65), Expect = 4.3 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 / +1 Query: 368 CRTWRSPAPPAARTCWPSRR 427 C WR+P+PPA + +P+RR Sbjct: 448 CPRWRTPSPPARLSLFPARR 507
>LOC_Os02g02360:12002.t00135:unspliced-genomic expressed protein| Length = 3287 Score = 32.7 bits (65), Expect = 4.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 / -1 Query: 371 RTWRSPAPPAARTCWPS 421 R WR P PP R+CW S Sbjct: 260 RRWRPPRPPPRRSCWRS 210
>LOC_Os01g02120:12001.t00107:unspliced-genomic OsMFT2 - Rice MFT-Like2 homogous to Arabidopsis Mother of FT and| TFL1 gene, expressed Length = 3087 Score = 24.9 bits (48), Expect(2) = 5.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 / -3 Query: 671 HIYACKLQRELVME 712 HIYACK Q +++E Sbjct: 625 HIYACKCQASVLVE 584 Score = 24.4 bits (47), Expect(2) = 5.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 / -1 Query: 746 MDGWMDGSHFVIVRDLAH 799 MDGW+D ++ V L H Sbjct: 549 MDGWIDQCAYIPVEKLPH 496
>LOC_Os11g20160:12011.t01786:unspliced-genomic O-methyltransferase ZRP4, putative, expressed| Length = 1774 Score = 32.2 bits (64), Expect = 5.9 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -3 / +3 Query: 429 VLRLGQHVLAAGGAGDRHVLQVRERPRLAGEEARQAP 319 VLR G HV G G R V V+E P +AG A + P Sbjct: 438 VLRPGHHVAPLRGRGVRAVRVVQEGPGVAGAVAVRGP 548
>LOC_Os02g13370:12002.t05465:unspliced-genomic expressed protein| Length = 1776 Score = 32.2 bits (64), Expect = 5.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 / +2 Query: 316 KRGLSSFFSGKSRSFANLQDVAVAGTTSSK 405 +RGLS+++ GKS+SF ++ D + K Sbjct: 959 RRGLSNYYQGKSQSFTSISDATCVQDLAKK 1048
>LOC_Os01g07070:12001.t00587:unspliced-genomic loricrin, putative, expressed| Length = 5483 Score = 32.2 bits (64), Expect = 5.9 Identities = 9/19 (47%), Positives = 16/19 (84%) Frame = -3 / -1 Query: 924 HMHHVWCSLSLFLHVKCNY 868 H HH++C+L LFL ++C++ Sbjct: 1373 HRHHLYCNLLLFLPLQCHH 1317
>LOC_Os04g52690:12004.t04743:unspliced-genomic PEX6, putative, expressed| Length = 5445 Score = 25.8 bits (50), Expect(2) = 7.0 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 / +1 Query: 377 WRSPAPPAARTCWPSRR 427 WR +R CWP RR Sbjct: 121 WRRRGSGGSRWCWPPRR 171 Score = 23.1 bits (44), Expect(2) = 7.0 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 / +3 Query: 496 TALPPFQPPEP 528 +ALPP PPEP Sbjct: 207 SALPPPPPPEP 239
>LOC_Os09g32220:12009.t02838:unspliced-genomic protein pob, putative, expressed| Length = 3524 Score = 25.8 bits (50), Expect(2) = 7.3 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = -2 / +2 Query: 898 LPLFACQMQLLASSKRIKKNLSSRRPLLLM*AEMSEIPDYY 776 +PLF C MQ++ S + + N R + L+ + + D + Sbjct: 2831 VPLFCCAMQIVPSCSKTRHNKYCRGVVQLISCHIIPLIDIF 2953 Score = 23.1 bits (44), Expect(2) = 7.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 / +3 Query: 713 FPLLIPFATCMH 678 FPLLI CMH Sbjct: 3060 FPLLISLTFCMH 3095
>LOC_Os11g19700:12011.t01740:unspliced-genomic cycloeucalenol cycloisomerase, putative, expressed| Length = 6336 Score = 31.8 bits (63), Expect = 8.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 / -2 Query: 724 REERDKMDGWMDGWIP 771 R R+ +GWMDGW+P Sbjct: 464 RARREGKNGWMDGWLP 417
>LOC_Os09g26240:12009.t02303:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 7865 Score = 31.8 bits (63), Expect = 8.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 / -2 Query: 713 TTLLGRRETRWMDGWMD 763 T L R RWMDGWMD Sbjct: 2368 TNQLFRESDRWMDGWMD 2318
>LOC_Os07g48370:12007.t04469:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 5068 Score = 31.8 bits (63), Expect = 8.1 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 / -1 Query: 718 STREERDKMDGWMDGWIPLCNSPGSRSSR 804 +T +DGWMD W+ C++ S S++ Sbjct: 115 TTTHNSQLIDGWMDRWVGGCSASASASAK 29
>LOC_Os02g53830:12002.t04962:unspliced-genomic MTD1, putative, expressed| Length = 2714 Score = 31.8 bits (63), Expect = 8.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 / +3 Query: 316 KRGLSSFFSGKSRSFANLQDVAV 384 ++G+ F++GKS SFA LQD + Sbjct: 2226 RKGVCKFYNGKSGSFAKLQDSVI 2294
>LOC_Os06g42070:12006.t03898:unspliced-genomic conserved hypothetical protein| Length = 2101 Score = 27.2 bits (53), Expect(2) = 8.3 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 / +3 Query: 533 KDGSGGWKGG 504 KDG GGW+GG Sbjct: 321 KDGDGGWEGG 350 Score = 25.8 bits (50), Expect(2) = 8.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 / +1 Query: 369 QVRERPRLAGEEARQAPLD 313 +VRER R GEE R P+D Sbjct: 637 RVRERERRKGEEGRCWPVD 693
>LOC_Os01g54670:12001.t04883:unspliced-genomic coiled-coil domain-containing protein 25, putative, expressed| Length = 4217 Score = 24.9 bits (48), Expect(2) = 9.6 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 / -3 Query: 749 DGWMDGSHFVIV 784 DGWMDGS V++ Sbjct: 3966 DGWMDGSDEVVL 3931 Score = 23.5 bits (45), Expect(2) = 9.6 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +1 / -3 Query: 664 THAYLCMQVAKGISNGNYSTREERDKMDGWMDG 762 T ++ V ++ RE DGWMDG Sbjct: 4047 TEKHVAAHVRYARTHARTHARERLLASDGWMDG 3949 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 247,997,182 Number of extensions: 3272524 Number of successful extensions: 20042 Number of sequences better than 10.0: 39 Length of query: 331 Length of database: 55,613,886 Length adjustment: 50 Effective length of query: 281 Effective length of database: 52,799,986 Effective search space: 14836796066 Effective search space used: 14836796066 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)