| Clone Name | FLbaf159d15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q9K015:NORM_NEIMB Probable multidrug resistance protein norM - N... | 31 | 6.5 |
|---|
>Q9K015:NORM_NEIMB Probable multidrug resistance protein norM - Neisseria meningitidis| serogroup B Length = 459 Score = 30.8 bits (68), Expect = 6.5 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 4/68 (5%) Frame = +1 Query: 490 AIKGQKVTPTPIHTHST---NIRVIC*TILVVH-NMSVYGLEELVSTSVCIVSVTLVGML 657 A++G KVT P+ H+ ++ +L NM +YG + S+ I ++ LV Sbjct: 386 ALRGYKVTKVPMFIHAAAFWGCGLLPGYLLAYRFNMGIYGFWTALIASLTIAAIALV--- 442 Query: 658 WCID*CRK 681 WC++ C + Sbjct: 443 WCLELCSR 450 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 98,709,259 Number of extensions: 1627806 Number of successful extensions: 4072 Number of sequences better than 10.0: 1 Number of HSP's gapped: 4069 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 100,686,439 Length adjustment: 111 Effective length of query: 155 Effective length of database: 70,239,694 Effective search space: 10887152570 Effective search space used: 10887152570 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)