| Clone Name | FLbaf152f09 |
|---|---|
| Clone Library Name | barley_pub |
>P31368:PDM1_DROME Protein nubbin - Drosophila melanogaster (Fruit fly)| Length = 601 Score = 32.3 bits (72), Expect = 1.7 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 22 PRSSQGHNPRKPSLSRSVKSPPKRTHHHN 108 PRSS H+ R P RS S P++ HHH+ Sbjct: 334 PRSSTPHSIRSPIAIRSPASSPQQLHHHH 362
>P98084:APBA2_MOUSE Amyloid beta A4 precursor protein-binding family A member 2 - Mus| musculus (Mouse) Length = 750 Score = 32.0 bits (71), Expect = 2.2 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 1 GPESLAIPRSSQGHNP-RKPSLSRSVKSPPKRTHHHNSGGGDQTKTRAP 144 G + A P S GH P R+ + +S+ PP+ H + G +TKTR P Sbjct: 260 GDSTEACPPSDTGHGPGRQEARPKSLNLPPEVKHPGDLQRGLKTKTRTP 308
>Q9Z2D6:MECP2_MOUSE Methyl-CpG-binding protein 2 - Mus musculus (Mouse)| Length = 484 Score = 31.2 bits (69), Expect = 3.8 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 25 RSSQGHNPRKPSLSRSVKSPPKRTHHHNSGGGDQTKTRAP 144 R S+ +P+ S S S SPPK+ HHH+ + TK P Sbjct: 344 RKSKESSPKGRSSSAS--SPPKKEHHHHHHHSESTKAPMP 381
>Q9UHR6:ZNHI2_HUMAN Zinc finger HIT domain-containing protein 2 - Homo sapiens (Human)| Length = 403 Score = 30.8 bits (68), Expect = 4.9 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -1 Query: 218 GGLGADGEEADPGSEAAVES--SRHRLGARVFVWSPPPELWWWVRFGG 81 GGL E PG +AA E SR G + W P WWW R G Sbjct: 93 GGLSGLWERLAPGEKAAFERLLSRGEAGRLLPPWRP----WWWNRGAG 136
>Q174I2:PRIC1_AEDAE Protein prickle - Aedes aegypti (Yellowfever mosquito)| Length = 916 Score = 30.4 bits (67), Expect = 6.4 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 25 RSSQGHNPRKPS-LSRSVKSPPKRTHHHNSGGGDQTKTRAPRRWRL 159 RSS H + S S S HHH+S G + R+PRR R+ Sbjct: 784 RSSHHHQHHRSSGESSSYSGTSYDRHHHSSSGSSSSNRRSPRRRRV 829
>Q95RW8:OPTIX_DROME Protein Optix - Drosophila melanogaster (Fruit fly)| Length = 487 Score = 30.0 bits (66), Expect = 8.4 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 93 HPPPQLRRRRPDENTSTKAMATALNRGLRSGIRLLAIGAEASKPASRGFHATG 251 HPPP+LR P++ ST A A G G + +P + G+H +G Sbjct: 421 HPPPKLRINSPEKLNSTAVAAAASVGG--------GGGNQHHEPTTTGYHHSG 465 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 107,896,861 Number of extensions: 2166466 Number of successful extensions: 6557 Number of sequences better than 10.0: 6 Number of HSP's gapped: 6546 Number of HSP's successfully gapped: 6 Length of query: 226 Length of database: 100,686,439 Length adjustment: 109 Effective length of query: 117 Effective length of database: 70,788,284 Effective search space: 8282229228 Effective search space used: 8282229228 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)