| Clone Name | FLbaf155a18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q3LU39:PROP1_GORGO Homeobox protein prophet of Pit-1 - Gorilla g... | 30 | 6.6 |
|---|
>Q3LU39:PROP1_GORGO Homeobox protein prophet of Pit-1 - Gorilla gorilla gorilla| (Lowland gorilla) Length = 225 Score = 30.0 bits (66), Expect = 6.6 Identities = 23/79 (29%), Positives = 32/79 (40%) Frame = -2 Query: 501 QHTKPHGRRQDNTRFRP*KLTEGDCTTKRHPYKKQQESASLITWHALKEPDTQIRKDKYI 322 Q +PH RR+ T F P +L + + R+ Y SL L E Q+ Sbjct: 62 QRGRPHSRRRHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNRR 121 Query: 321 FSAISMRCAN*LQPLIHLT 265 C+ LQPL HL+ Sbjct: 122 AKQRKQECSL-LQPLAHLS 139 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 84,539,285 Number of extensions: 1530644 Number of successful extensions: 3425 Number of sequences better than 10.0: 1 Number of HSP's gapped: 3425 Number of HSP's successfully gapped: 1 Length of query: 200 Length of database: 100,686,439 Length adjustment: 108 Effective length of query: 92 Effective length of database: 71,062,579 Effective search space: 6537757268 Effective search space used: 6537757268 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)