| Clone Name | FLbaf151m12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q7Z3V4:UBE3B_HUMAN Ubiquitin-protein ligase E3B - Homo sapiens (... | 35 | 2.0 | 2 | Q8C033:ARHGA_MOUSE Rho guanine nucleotide exchange factor 10 - M... | 33 | 5.8 | 3 | Q9ES34:UBE3B_MOUSE Ubiquitin-protein ligase E3B - Mus musculus (... | 33 | 7.6 |
|---|
>Q7Z3V4:UBE3B_HUMAN Ubiquitin-protein ligase E3B - Homo sapiens (Human)| Length = 1068 Score = 34.7 bits (78), Expect = 2.0 Identities = 21/51 (41%), Positives = 28/51 (54%) Frame = +2 Query: 1706 PCLVEMLSNINYSLFTRVVVVLC*FSDTLITPYLVDMMSNSFLVEHYSSYT 1858 PCL + +SL R V+ FSD LI P+L+ +MS LV H S+ T Sbjct: 222 PCLSKGTLTAAFSLALRPVIAAQ-FSDNLIRPFLIHIMSVPALVTHLSTVT 271
>Q8C033:ARHGA_MOUSE Rho guanine nucleotide exchange factor 10 - Mus musculus (Mouse)| Length = 1345 Score = 33.1 bits (74), Expect = 5.8 Identities = 29/83 (34%), Positives = 39/83 (46%), Gaps = 14/83 (16%) Frame = -3 Query: 1341 TSPRRKPLHQLSLRYPPLQMTNPPFLLLLQTMLKSFLNHMAD----QKALEKSQTISV-- 1180 +SP R LH L +R P+Q P F+LLLQ MLK+ D Q AL + +T++ Sbjct: 525 SSPDRVTLHSLMMR--PIQRF-PQFILLLQDMLKNTAKGHPDRLPLQMALTELETLAEKL 581 Query: 1179 --------DRCANKNIVEGAGER 1135 RC K I + ER Sbjct: 582 NERKRDADQRCEIKQIAKAINER 604
>Q9ES34:UBE3B_MOUSE Ubiquitin-protein ligase E3B - Mus musculus (Mouse)| Length = 1070 Score = 32.7 bits (73), Expect = 7.6 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = +2 Query: 1706 PCLVEMLSNINYSLFTRVVVVLC*FSDTLITPYLVDMMSNSFLVEHYSS 1852 PCL + + +SL R VV FSD L+ P+++ +MS LV H S+ Sbjct: 222 PCLSKGMLTAAFSLALRPVVAAQ-FSDNLMRPFIIHVMSVPALVAHLST 269 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 442,996,554 Number of extensions: 9829644 Number of successful extensions: 22056 Number of sequences better than 10.0: 3 Number of HSP's gapped: 22049 Number of HSP's successfully gapped: 3 Length of query: 849 Length of database: 100,686,439 Length adjustment: 122 Effective length of query: 727 Effective length of database: 67,222,449 Effective search space: 48870720423 Effective search space used: 48870720423 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)