ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf151i20 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os02g55140:12002.t05090:unspliced-genomic leucine aminopeptidase 3, chloroplast precursor, putative, expressed| Length = 3437 Score = 143 bits (307), Expect(5) = e-110 Identities = 58/64 (90%), Positives = 62/64 (96%) Frame = +1 / +2 Query: 313 AGIFTPSDELAQEVTAASELSGEKFWRLPMEESYWEQMKSGVADMVNTGGRQGGSITAAL 492 AGIFTPSDELA+EV AASE+SGEKFWR+P+EESYWE MKSGVADMVNTGGRQGGSITAAL Sbjct: 2582 AGIFTPSDELAKEVAAASEISGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGSITAAL 2761 Query: 493 FLKQ 504 FLKQ Sbjct: 2762 FLKQ 2773 Score = 138 bits (297), Expect(5) = e-110 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = +1 / +3 Query: 1 MKFDMGGSAAVFGAAKALAQIKPPGVEVHFIVAACENMISGTGMRPGDILTASNGKTIEV 180 MKFDMGGSAAVFGAAKAL QIKPPGVEVHFIVAACENMISGTGMRPGDI+TASNGKTIEV Sbjct: 1764 MKFDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEV 1943 Score = 88.6 bits (187), Expect(5) = e-110 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 / +2 Query: 484 AALFLKQFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTL 603 A+ QFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTL Sbjct: 2879 ASCLYLQFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTL 2998 Score = 68.0 bits (142), Expect(5) = e-110 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 / +1 Query: 172 IEVNNTDAEGRLTLADALVYACNQGVDKII 261 ++VNNTDAEGRLTLADALVYACNQGVDK++ Sbjct: 2062 LQVNNTDAEGRLTLADALVYACNQGVDKVM 2151 Score = 51.0 bits (105), Expect(5) = e-110 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 / +1 Query: 255 DY*SGNTNRCLCCCTWA*HCW 317 DY*SGNT C+C CTWA*HCW Sbjct: 2422 DY*SGNTYWCMCRCTWA*HCW 2484 Score = 127 bits (272), Expect(6) = 6e-86 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -1 / -2 Query: 179 TSIVFPLEAVKMSPGLIPVPLIIFSQAATIK*TSTPGGLIWAKAFAAPNTAAEPPMSNF 3 TSIVFPLEAV MSPGL+PVPLI+FSQAATIK*TSTPGGLIW KAFAAP TAAEPPMSNF Sbjct: 1942 TSIVFPLEAVTMSPGLMPVPLIMFSQAATIK*TSTPGGLIWPKAFAAPKTAAEPPMSNF 1766 Score = 123 bits (264), Expect(6) = 6e-86 Identities = 55/64 (85%), Positives = 56/64 (87%) Frame = -1 / -3 Query: 503 CFRNRAAVMEPPCRPPVLTMSATPDFICSQ*LSSMGNLQNFSPDNSDAAVTSWASSSLGV 324 CFR AAV+EPPCRPPVLTMSATPDFI SQ*LSS G LQNFSPD SDAA TS ASSSLGV Sbjct: 2772 CFRKSAAVIEPPCRPPVLTMSATPDFIDSQ*LSSSGILQNFSPDISDAAATSLASSSLGV 2593 Query: 323 KIPA 312 KIPA Sbjct: 2592 KIPA 2581 Score = 55.1 bits (114), Expect(6) = 6e-86 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -3 / -2 Query: 603 QGGHAEPGRGTLLVVPHRAGHVDVHPLNLLVDKL 502 QGG AE G LLVVPH GHV+VHPL+LL+ KL Sbjct: 2998 QGGDAESGGRPLLVVPHWPGHVNVHPLHLLIHKL 2897 Score = 51.5 bits (106), Expect(6) = 6e-86 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 / -2 Query: 253 CQHLDYKHRPKHQQA*ASLQRQCYLPQ 173 CQHLDYK PKHQQ *A QCYLP+ Sbjct: 2143 CQHLDYKRTPKHQQV*AFPPHQCYLPE 2063 Score = 47.3 bits (97), Expect(6) = 6e-86 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 / -3 Query: 320 IPAMLGPSATTQAPVSVARSII 255 +PAMLGPSATT APVSVARSII Sbjct: 2487 LPAMLGPSATTHAPVSVARSII 2422 Score = 22.6 bits (43), Expect(6) = 6e-86 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 / -3 Query: 626 DEFLRTHS 603 DEFLRTHS Sbjct: 3024 DEFLRTHS 3001 Score = 133 bits (285), Expect(5) = 9e-72 Identities = 50/59 (84%), Positives = 53/59 (89%) Frame = +3 / +2 Query: 3 EV*HGRLCGSVWCSKSFGPNQASWSRGSLYCCCL*EYD*WHRNETW*HFDCF*REDD*G 179 EV*HGRLC S WCSKSFGPNQA WSRGS YCCCL*++D*WHR+ETW*H DCF*RED *G Sbjct: 1766 EV*HGRLCSSFWCSKSFGPNQAPWSRGSFYCCCL*KHD*WHRHETW*HCDCF*REDY*G 1942 Score = 77.6 bits (163), Expect(5) = 9e-72 Identities = 38/64 (59%), Positives = 42/64 (65%) Frame = +3 / +1 Query: 312 CWNLHTK**TSPRSHCCI*VIGGEVLEIAHGGKLLGADEVWCG*HGQYRRSTGRFHHSCP 491 C N H K**TS S C I* I EVLE A GKLLG DEVWC *HG +R G F++ C Sbjct: 2581 CRNFHAK**TS*GSCCGI*DIRREVLENATRGKLLGVDEVWCC*HG*HRWPAGWFYYCCT 2760 Query: 492 VPET 503 +PET Sbjct: 2761 LPET 2772 Score = 59.3 bits (123), Expect(5) = 9e-72 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = +2 / +3 Query: 503 SLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPW 604 SL RR SGCT TWP +CGTTRS P SA PPW Sbjct: 2898 SLWMRRCSGCTLTWPGQCGTTRSGRPPDSASPPW 2999 Score = 49.6 bits (102), Expect(5) = 9e-72 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 / +2 Query: 256 IIDLATLTGACVVALGPSIAG 318 IIDLATLTGACVVALGPSIAG Sbjct: 2423 IIDLATLTGACVVALGPSIAG 2485 Score = 40.5 bits (82), Expect(5) = 9e-72 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = +3 / +3 Query: 177 GK*H*R*REAYAC*CFGLCL*SRC*Q 254 GK*H* +AY C*CFG+ L*SRC*Q Sbjct: 2067 GK*H*CGGKAYTC*CFGVRL*SRC*Q 2144 Score = 126 bits (269), Expect(5) = 3e-71 Identities = 49/60 (81%), Positives = 53/60 (88%) Frame = -3 / -1 Query: 180 YLNRLPVRSSQNVTRSHSCATNHILTGSNNKVNLYSRRLDLGQSFCCTKHCRRASHVKLH 1 YLN LPVRSS NVTRSH+CATNH+ T SNNK+NLYSR LDL QSFCCTK+C RASHVKLH Sbjct: 1943 YLNSLPVRSSHNVTRSHACATNHVFTSSNNKMNLYSRGLDLAQSFCCTKNCCRASHVKLH 1764 Score = 87.2 bits (184), Expect(5) = 3e-71 Identities = 39/63 (61%), Positives = 46/63 (73%) Frame = -3 / -2 Query: 504 LFQEQGSCDGTALSTAGIDHVSHTRLHLLPVAFLHGQSPELLPR*LRCSSDFLG*FITWC 325 LFQE+ S + T L G++HVS+TRLH LPVAFL SPELL LRC S+FL *FITW Sbjct: 2773 LFQEECSSNRTTLPATGVNHVSNTRLHRLPVAFLEWHSPELLS*YLRCRSNFLS*FITWR 2594 Query: 324 EDS 316 E+S Sbjct: 2593 ENS 2585 Score = 52.8 bits (109), Expect(5) = 3e-71 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = -2 / -1 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQL 482 W RR R ASCRST RPC+CAST PS QT + + +L Sbjct: 2993 WRRRIRWPPASCRSTLARPCQCASTAPSHPQTANTSMRL 2877 Score = 46.4 bits (95), Expect(5) = 3e-71 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -3 / -3 Query: 255 LVNTLITSIDQSISKRKPPFSVSVIYLNR 169 LVNTLITS+ QSISK KP +SVIYL + Sbjct: 2145 LVNTLITSVHQSISKCKPSLRISVIYLKK 2059 Score = 46.0 bits (94), Expect(5) = 3e-71 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -3 / -2 Query: 318 SSNARPKCNNTGTG*CCQINNL 253 +SNARPKCN+T T CCQINNL Sbjct: 2485 TSNARPKCNDTCTSKCCQINNL 2420 Score = 100 bits (213), Expect(4) = 7e-39 Identities = 46/60 (76%), Positives = 50/60 (83%) Frame = -2 / -3 Query: 181 LPQSSSR*KQSKCHQVSFLCH*SYSHRXXX*SEPLLQEA*FGPKLLLHQTLPQSLPCQTS 2 +PQ SSR*KQS+CHQVS LCH*S H+ *+EPLLQ A*FGPKLLLHQ L QSLPCQTS Sbjct: 1944 IPQ*SSR*KQSQCHQVSCLCH*SCFHKQQQ*NEPLLQGA*FGPKLLLHQKLLQSLPCQTS 1765 Score = 83.1 bits (175), Expect(4) = 7e-39 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = -1 / -3 Query: 605 SRVDTPNPVAARFLSFHTGPAMSMCIH*TFSSTNCFRNRAAVMEPPC 465 +RV+TPNPVAARFLSFHTGPAMSMCIH TFSSTNC A + C Sbjct: 3000 TRVETPNPVAARFLSFHTGPAMSMCIHCTFSSTNCKYKHEAPLACHC 2860 Score = 22.6 bits (43), Expect(4) = 7e-39 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 / -1 Query: 289 HRHRLVLPDQ*S 254 H H+ VLPDQ*S Sbjct: 2456 HMHQ*VLPDQ*S 2421 Score = 22.6 bits (43), Expect(4) = 7e-39 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 / -1 Query: 260 IILSTP*LQA*TK 222 I LSTP*LQA TK Sbjct: 2150 ITLSTP*LQAYTK 2112 Score = 74.4 bits (156), Expect(4) = 3e-30 Identities = 38/62 (61%), Positives = 41/62 (66%) Frame = +2 / +3 Query: 317 ESSHQVMN*PKKSLLHLSYRGRSSGDCPWRKATGSR*SLVWLTWSIPAVDRAVPSQLPCS 496 E S QVMN* +K L HL Y+ RSSG+C RKATGSR*SLV LTW P R V L S Sbjct: 2586 EFSRQVMN*LRKLLRHLRYQERSSGECHSRKATGSR*SLVLLTWLTPVAGRVVLLLLHSS 2765 Query: 497 *N 502 *N Sbjct: 2766 *N 2771 Score = 56.5 bits (117), Expect(4) = 3e-30 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = +3 / +1 Query: 504 VCRREGSVDAHRHGRPGVERQEACRDRVRRVHPG 605 VC EG+VDAH HGR VERQEA R+RR+HPG Sbjct: 2899 VCG*EGAVDAH*HGRASVERQEAGGHRIRRLHPG 3000 Score = 45.1 bits (92), Expect(4) = 3e-30 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +2 / +1 Query: 2 *SLTWEALRQCLVQQKLWPKSS 67 *SLTWEAL+Q LVQQKLW KSS Sbjct: 1765 *SLTWEALQQFLVQQKLWAKSS 1830 Score = 23.1 bits (44), Expect(4) = 3e-30 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +2 / +2 Query: 224 WSMLVIKVLTR 256 W LVIKVLTR Sbjct: 2114 WCTLVIKVLTR 2146 Score = 62.5 bits (130), Expect(2) = 4e-09 Identities = 31/49 (63%), Positives = 32/49 (65%) Frame = -2 / -1 Query: 502 VSGTGQL*WNRPVDRRY*PCQPHQTSSAPSSFPPWAISRTSPPITQMQQ 356 VSG Q * N P R *PCQ HQTSS PSSFP A SRTS I+QM Q Sbjct: 2771 VSGRVQQ**NHPAGHRC*PCQQHQTSSTPSSFPRVAFSRTSLLISQMPQ 2625 Score = 23.5 bits (45), Expect(2) = 4e-09 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 / -3 Query: 60 LGQSFCCTKHCRR 22 L QS CC+ HC++ Sbjct: 1746 LVQS*CCSHHCKK 1708
>LOC_Os12g24650:12012.t02189:unspliced-genomic leucine aminopeptidase 1, chloroplast precursor, putative, expressed| Length = 5220 Score = 118 bits (253), Expect(6) = 1e-88 Identities = 49/63 (77%), Positives = 53/63 (84%) Frame = +1 / +1 Query: 316 GIFTPSDELAQEVTAASELSGEKFWRLPMEESYWEQMKSGVADMVNTGGRQGGSITAALF 495 GI TPSDEL +EV AA E SGEKFWRLP+EESYWEQMKS VADM+NTG GG+ITA LF Sbjct: 3721 GILTPSDELDKEVAAAYEASGEKFWRLPLEESYWEQMKSSVADMLNTGSPLGGAITAGLF 3900 Query: 496 LKQ 504 LKQ Sbjct: 3901 LKQ 3909 Score = 80.3 bits (169), Expect(6) = 1e-88 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 / +3 Query: 490 LFLKQFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTL 603 LF QFVDEKV+WMH+DMAGPVWN KK+ ATGFGVSTL Sbjct: 4824 LFSLQFVDEKVKWMHVDMAGPVWNYKKQEATGFGVSTL 4937 Score = 77.6 bits (163), Expect(6) = 1e-88 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 / +3 Query: 70 PGVEVHFIVAACENMISGTGMRPGDILTASNGKTIEV 180 P +VHFI AACENMISGTGMRPGDI+TASNGKTIEV Sbjct: 2574 P*SQVHFISAACENMISGTGMRPGDIVTASNGKTIEV 2684 Score = 60.2 bits (125), Expect(6) = 1e-88 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +1 / +1 Query: 172 IEVNNTDAEGRLTLADALVYACNQGVDKII 261 ++V+NTDAEGRLTLADALVYAC GVDK++ Sbjct: 3064 VQVDNTDAEGRLTLADALVYACKLGVDKVM 3153 Score = 59.3 bits (123), Expect(6) = 1e-88 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 / +1 Query: 1 MKFDMGGSAAVFGAAKALAQIKPPGVEV 84 MK DMGGSAA+FGAAKAL QIKPPGVEV Sbjct: 2422 MKKDMGGSAALFGAAKALGQIKPPGVEV 2505 Score = 43.7 bits (89), Expect(6) = 1e-88 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +1 / +1 Query: 253 KIIDLATLTGACVVALGPSIAG 318 +IIDLATLTG C +ALGPSIAG Sbjct: 3529 QIIDLATLTGYCRIALGPSIAG 3594 Score = 101 bits (216), Expect(6) = 1e-70 Identities = 46/66 (69%), Positives = 52/66 (78%) Frame = -1 / -2 Query: 503 CFRNRAAVMEPPCRPPVLTMSATPDFICSQ*LSSMGNLQNFSPDNSDAAVTSWASSSLGV 324 CFRN AV+ PP PVL++SAT DFICSQ*LSS G+LQNFSPD S AA TS +SSSLGV Sbjct: 3908 CFRNSPAVIAPPSGLPVLSISATLDFICSQ*LSSSGSLQNFSPDASYAAATSLSSSSLGV 3729 Query: 323 KIPAML 306 KIP + Sbjct: 3728 KIPVKI 3711 Score = 67.0 bits (140), Expect(6) = 1e-70 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 / -3 Query: 605 SRVDTPNPVAARFLSFHTGPAMSMCIH*TFSSTNC 501 + VDTPNPVA+ FL F TGPAMS CIH TFSSTNC Sbjct: 4939 TNVDTPNPVASCFL*FQTGPAMSTCIHFTFSSTNC 4835 Score = 66.1 bits (138), Expect(6) = 1e-70 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -1 / -3 Query: 179 TSIVFPLEAVKMSPGLIPVPLIIFSQAATIK*TSTPG 69 TSIVFPLEAV MSPGL+PVPLIIFS AA IK*T G Sbjct: 2683 TSIVFPLEAVTMSPGLMPVPLIIFSHAAEIK*TCDQG 2573 Score = 58.8 bits (122), Expect(6) = 1e-70 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 / -2 Query: 83 TSTPGGLIWAKAFAAPNTAAEPPMSNF 3 TSTPGGLIW KAFAAPN AAEPP+S F Sbjct: 2504 TSTPGGLIWPKAFAAPNNAAEPPISFF 2424 Score = 45.1 bits (92), Expect(6) = 1e-70 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -2 / -3 Query: 253 CQHLDYKHRPKHQQA*ASLQRQCYLPQSSSR 161 CQH Y+H PKHQQ *A L QC P+ S R Sbjct: 3145 CQHPVYRHIPKHQQV*AFLLHQCCPPEQSDR 3053 Score = 40.5 bits (82), Expect(6) = 1e-70 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -1 / -2 Query: 320 IPAMLGPSATTQAPVSVARSII 255 +PAMLGPSA Q PVSVARSII Sbjct: 3596 LPAMLGPSAILQ*PVSVARSII 3531 Score = 69.8 bits (146), Expect(6) = 7e-52 Identities = 32/62 (51%), Positives = 40/62 (64%) Frame = -3 / -1 Query: 504 LFQEQGSCDGTALSTAGIDHVSHTRLHLLPVAFLHGQSPELLPR*LRCSSDFLG*FITWC 325 L Q+ S + T T G+ H+S+ RLHLLP+AF QSPELL L C SDFL FITW Sbjct: 3909 LLQK*SSRNCTTQRTTGVKHISNARLHLLPIAFF*WQSPELLS*CLICGSDFLVQFITWS 3730 Query: 324 ED 319 ++ Sbjct: 3729 QN 3724 Score = 57.0 bits (118), Expect(6) = 7e-52 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = -3 / -1 Query: 81 LYSRRLDLGQSFCCTKHCRRASHVKLH 1 LYSRRLDL QSFCCTK C RA+H+ LH Sbjct: 2502 LYSRRLDLAQSFCCTKQCCRATHIFLH 2422 Score = 55.1 bits (114), Expect(6) = 7e-52 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = -3 / -2 Query: 180 YLNRLPVRSSQNVTRSHSCATNHILTGSNNKVNLYSRRL 64 YLN +RSS NVTR H+CAT HI S NK+NL S +L Sbjct: 2684 YLNSFSIRSSHNVTRPHACATYHIFACSRNKMNL*SGKL 2568 Score = 49.6 bits (102), Expect(6) = 7e-52 Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = -3 / -2 Query: 603 QGGHAEPGRGTLLVVPHRAGHVDVHPLNLLVDKL 502 Q GHAE G L VVP+R HV+VHPL+ L++KL Sbjct: 4937 QCGHAESGGFLLFVVPNRPSHVNVHPLHFLINKL 4836 Score = 42.8 bits (87), Expect(6) = 7e-52 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -3 / -1 Query: 255 LVNTLITSIDQSISKRKPPFSVSVIYLNRL 166 LVNT T I QSISK KP F +SV++LN++ Sbjct: 3147 LVNTQFTGIYQSISKCKPSFCISVVHLNKV 3058 Score = 40.5 bits (82), Expect(6) = 7e-52 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 / -1 Query: 318 SSNARPKCNNTGTG*CCQINNLV 250 +SNAR KCN+ T CCQINNL+ Sbjct: 3594 TSNARTKCNSAVTSKCCQINNLL 3526 Score = 57.0 bits (118), Expect(6) = 2e-45 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +3 / +3 Query: 12 HGRLCGSVWCSKSFGPNQASWSRGS 86 +G LC VWCSKSFGPNQASWSRG+ Sbjct: 2433 YGWLCSIVWCSKSFGPNQASWSRGT 2507 Score = 55.1 bits (114), Expect(6) = 2e-45 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = +3 / +2 Query: 81 GSLYCCCL*EYD*WHRNETW*HFDCF*REDD*G 179 GS Y CC+ +YD WHR+E W*H DCF* ++ *G Sbjct: 2585 GSFYFCCMRKYDKWHRHEAW*HCDCF*WKNY*G 2683 Score = 50.6 bits (104), Expect(6) = 2e-45 Identities = 26/53 (49%), Positives = 33/53 (62%) Frame = +2 / +2 Query: 329 QVMN*PKKSLLHLSYRGRSSGDCPWRKATGSR*SLVWLTWSIPAVDRAVPSQL 487 QVMN +KSL H+ ++ RSSGDC +KA GS+*SL L P V V +L Sbjct: 3734 QVMNWTRKSLPHMRHQERSSGDCH*KKAIGSK*SLALLICLTPVVRWVVQLRL 3892 Score = 50.1 bits (103), Expect(6) = 2e-45 Identities = 21/38 (55%), Positives = 23/38 (60%) Frame = +2 / +1 Query: 503 SLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 SL R+ SGCT TW R GTT+S P SACP W S Sbjct: 4837 SLLMRK*SGCTLTWLGRFGTTKSKKPPDSACPHWWSGS 4950 Score = 40.5 bits (82), Expect(6) = 2e-45 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +3 / +3 Query: 255 DY*SGNTNRCLCCCTWA*HCW 317 DY*SGNT L CTW+*HCW Sbjct: 3531 DY*SGNTYWLLQNCTWS*HCW 3593 Score = 39.6 bits (80), Expect(6) = 2e-45 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +3 / +3 Query: 186 H*R*REAYAC*CFGLCL*SRC*Q 254 H* R+AY C*CFG+CL*+ C*Q Sbjct: 3078 H*CRRKAYTC*CFGICL*TGC*Q 3146 Score = 49.6 bits (102), Expect(3) = 2e-13 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = -2 / -3 Query: 109 SHRXXX*SEPLLQEA*FGPKLLLHQTLPQSLPCQTS 2 SH+ PLLQEA*FGPKLLLHQT+ QS P +S Sbjct: 2530 SHK*LKREVPLLQEA*FGPKLLLHQTMLQSHPYLSS 2423 Score = 40.5 bits (82), Expect(3) = 2e-13 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = -2 / -1 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRRQT 503 WTRR R A C S P +PC+ AST S +QT Sbjct: 4932 WTRRIRWLLAFCSSKPAQPCQRASTSLSHQQT 4837 Score = 32.2 bits (64), Expect(3) = 2e-13 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = -2 / -3 Query: 487 QL*WNRPVDRRY*PCQPHQTSSAPSSFPPWAISRTSPPITQMQQ 356 Q * + P D R * Q TS AP+SF A+SRTS + M+Q Sbjct: 3892 QP*LHHPADYRC*AYQQR*TSFAPNSFLLVAVSRTSLLMPHMRQ 3761 Score = 38.6 bits (78), Expect(3) = 7e-11 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = +3 / +2 Query: 504 VCRREGSVDAHRHGRPGVERQEACRDRVRRVHPG 605 VC E VDA HG G+E Q+A R+RRVH G Sbjct: 4838 VC**ESEVDAR*HGWAGLELQKARSHRIRRVHIG 4939 Score = 38.2 bits (77), Expect(3) = 7e-11 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +2 / +2 Query: 14 WEALRQCLVQQKLWPKSS 67 W AL+ CLVQQKLW KSS Sbjct: 2435 WVALQHCLVQQKLWAKSS 2488 Score = 36.8 bits (74), Expect(3) = 7e-11 Identities = 26/58 (44%), Positives = 33/58 (56%) Frame = +3 / +3 Query: 327 TK**TSPRSHCCI*VIGGEVLEIAHGGKLLGADEVWCG*HGQYRRSTGRFHHSCPVPE 500 +K**T S C I* I EVLE A KLLGA+EV *+ +R S G ++ + E Sbjct: 3732 SK**TGQGSRCRI*GIRREVLETATRRKLLGANEV*RC*YA*HR*SAGWCNYGWTISE 3905 Score = 42.3 bits (86), Expect = 0.005 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = -2 / -1 Query: 181 LPQSSSR*KQSKCHQVSFLCH*SYSHRXXX*SEPLLQE 68 +PQ *KQS+CHQ S LCH SY *+EP+++E Sbjct: 2685 IPQ*FFH*KQSQCHQASCLCHLSYFRMQQK*NEPVIRE 2572
>LOC_Os08g36450:12008.t03385:unspliced-genomic expressed protein| Length = 1692 Score = 44.1 bits (90), Expect = 0.001 Identities = 24/64 (37%), Positives = 31/64 (48%) Frame = -2 / +2 Query: 592 RRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQL*WNRPVDRRY*PCQPHQTSSAPS 413 R RS A+ R+TP RP A+ SR S + + W RP R P P SAP+ Sbjct: 407 RPRRSTTATTRATPRRPLAPAAPPASRPPASSPSARDPWTRPAARLRHPPSPRGAPSAPA 586 Query: 412 SFPP 401 + PP Sbjct: 587 APPP 598
>LOC_Os01g38970:12001.t03430:unspliced-genomic carbamoyl-phosphate synthase large chain, putative, expressed| Length = 5160 Score = 40.9 bits (83), Expect = 0.013 Identities = 20/51 (39%), Positives = 26/51 (50%) Frame = +2 / -3 Query: 437 WLTWSIPAVDRAVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGS 589 W WS A R+ P + PC+ S S+R + S W R G+ S PRP S Sbjct: 367 WPGWS*RAPPRSPPRRAPCTPASRSSRTRTPARSRWGRRRGS*SSSPRPAS 215
>LOC_Os09g39920:12009.t03456:unspliced-genomic beta-1,4-mannan synthase, putative, expressed| Length = 5443 Score = 31.3 bits (62), Expect(2) = 0.018 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 / +3 Query: 524 SGCTSTWPARCGTTRSVPRPGSACPP 601 SGC ++ PARC T + G A PP Sbjct: 4665 SGCGTSCPARCARTGTSSTGGRAAPP 4742 Score = 26.7 bits (52), Expect(2) = 0.018 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 / +3 Query: 398 PWRKATGSR*SLVWLTWS 451 PWR+ G R W TW+ Sbjct: 4560 PWRRRAGGRSGRRWRTWT 4613
>LOC_Os11g31590:12011.t02756:unspliced-genomic armadillo/beta-catenin-like repeat family protein, expressed| Length = 1428 Score = 29.0 bits (57), Expect(2) = 0.035 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 / +2 Query: 403 PWAISRTSPPIT 368 PWA SRTSPP T Sbjct: 728 PWAASRTSPPAT 763 Score = 28.1 bits (55), Expect(2) = 0.035 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 / +2 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSRRQTVSGT 491 R +R SCR RPC C+ R + S T Sbjct: 527 RCSTRGRSCRRRARRPCPCSPRRRPRPRACSAT 625
>LOC_Os03g47280:12003.t04090:unspliced-genomic VQ motif family protein, expressed| Length = 680 Score = 31.3 bits (62), Expect(2) = 0.036 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 / +2 Query: 473 PPCRPPVLTMSATPDFI 423 PPCRPP T S+T D + Sbjct: 455 PPCRPPATTASSTMDMV 505 Score = 25.8 bits (50), Expect(2) = 0.036 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 / +2 Query: 583 RSRHASCRSTPGRPCRCASTEPSR 512 R R + G PCRC++ P R Sbjct: 395 RRRRTCSTTRRGSPCRCSARPPCR 466
>LOC_Os10g30100:12010.t02344:unspliced-genomic nucleolar protein, putative, expressed| Length = 6463 Score = 38.6 bits (78), Expect = 0.066 Identities = 18/48 (37%), Positives = 21/48 (43%) Frame = +2 / +2 Query: 476 PSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSR 619 P P TRR G TST P + S P S+ PPW+ S R Sbjct: 215 PPSAPPPSTRSGTRRSPGTTSTTPRTGSSASSTTWPSSSAPPWTSSRR 358
>LOC_Os01g06040:12001.t00488:unspliced-genomic conserved hypothetical protein| Length = 1375 Score = 38.2 bits (77), Expect = 0.090 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = -2 / +2 Query: 595 TRRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTG 488 TRR R R S S+P RP C+S P+R + S +G Sbjct: 44 TRRRRRRRPSSCSSPRRPRSCSSPRPARTSSTSSSG 151
>LOC_Os03g35710:12003.t03054:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4473 Score = 28.1 bits (55), Expect(4) = 0.17 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 / -2 Query: 568 SCRSTPGRPCRCASTEPSR 512 +CR P CRC + PSR Sbjct: 1853 ACRRAPPSHCRCRTASPSR 1797 Score = 24.4 bits (47), Expect(4) = 0.17 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -1 / -2 Query: 497 RNRAAVMEPPCR 462 R+RAAV PPCR Sbjct: 1229 RSRAAVPVPPCR 1194 Score = 23.1 bits (44), Expect(4) = 0.17 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 / -1 Query: 395 NLQNFSPDNSDAAVTSWASSSLGVKIP 315 NL P + V W SSSLG+ P Sbjct: 114 NLSLLLP*GTPNPVRRWPSSSLGLPSP 34 Score = 22.6 bits (43), Expect(4) = 0.17 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -3 / -2 Query: 786 FLHETLPYSIAPQSLRQ 736 FLH LP P LRQ Sbjct: 3023 FLHCKLPVDYCPDGLRQ 2973
>LOC_Os06g09640:12006.t00842:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2965 Score = 37.3 bits (75), Expect = 0.17 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 / +1 Query: 592 RRTRSRHASCRSTPGRPCRCA 530 RR+R+RHAS R P RPCR A Sbjct: 2749 RRSRARHASGRRLPSRPCRAA 2811
>LOC_Os03g61130:12003.t05346:unspliced-genomic hydrolase, acting on ester bonds, putative, expressed| Length = 2991 Score = 37.3 bits (75), Expect = 0.17 Identities = 21/54 (38%), Positives = 24/54 (44%) Frame = -1 / +1 Query: 593 TPNPVAARFLSFHTGPAMSMCIH*TFSSTNCFRNRAAVMEPPCRPPVLTMSATP 432 TP + R S T PA S T S T+ R+ A PPCRPP TP Sbjct: 391 TPPTLPPRRSSSPTRPATSTPTPATASRTSASRSSAPPTPPPCRPPCPASPRTP 552
>LOC_Os02g57810:12002.t05352:unspliced-genomic cytochrome P-450-like protein, putative| Length = 1596 Score = 24.0 bits (46), Expect(3) = 0.21 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 / -3 Query: 448 PCQPHQTSSAPSSFP 404 PC+P + +S+PSS P Sbjct: 559 PCRPTRPASSPSSPP 515 Score = 23.1 bits (44), Expect(3) = 0.21 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 / -3 Query: 598 WTRRTRSRHASCRSTPGR 545 W R R R CRS P R Sbjct: 676 WRRWRRRRRRRCRSWPWR 623 Score = 23.1 bits (44), Expect(3) = 0.21 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 / -3 Query: 497 RNRAAVMEPPCRP 459 R R++ PPCRP Sbjct: 586 RRRSSAPTPPCRP 548
>LOC_Os05g40010:12005.t03541:unspliced-genomic nonspecific lipid-transfer protein precursor, putative, expressed| Length = 1666 Score = 29.5 bits (58), Expect(2) = 0.21 Identities = 15/47 (31%), Positives = 18/47 (38%) Frame = -2 / +1 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQL*WNRPVDR 458 W R R R C + R CR S E R+ +G W R R Sbjct: 169 WWRGRRCRARRCTTRCCRACRTCSREGRCRRRAAGGSGASWRRRAPR 309 Score = 24.9 bits (48), Expect(2) = 0.21 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 / +1 Query: 418 PSSFPPWAISRTSPP 374 P++ PP SRTSPP Sbjct: 310 PTAAPPAPASRTSPP 354
>LOC_Os05g11860:12005.t01017:unspliced-genomic RING-H2 finger protein ATL3F, putative, expressed| Length = 783 Score = 31.8 bits (63), Expect(2) = 0.22 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 / +2 Query: 583 RSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQ 485 RS +TP R CRC+ T RR + GQ Sbjct: 368 RSGRLGWMTTPSRRCRCSRTSKGRRAAAARWGQ 466 Score = 22.6 bits (43), Expect(2) = 0.22 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -2 / +2 Query: 445 CQPHQTSSAPSSFPPWAISR 386 C T APS+ P W + R Sbjct: 584 CGSGSTRRAPSAAPRWLLGR 643
>LOC_Os12g09320:12012.t00811:unspliced-genomic amino acid carrier, putative| Length = 1407 Score = 36.8 bits (74), Expect = 0.23 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = -2 / -3 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTG 488 RTRSR C +P R CRC + RR T S G Sbjct: 145 RTRSRR**CARSPSRTCRCGAAARRRRATPSPPG 44
>LOC_Os08g43654:12008.t04090:unspliced-genomic transparent testa 12 protein, putative, expressed| Length = 5866 Score = 36.8 bits (74), Expect = 0.23 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +2 / +3 Query: 476 PSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 PS C ++ +R FS C S W + +RS R GS+C S +S Sbjct: 4206 PSPRRCCCSTSRSRGFSSCRSGWASSASPSRSTCRGGSSCSASSPTS 4346
>LOC_Os11g43640:12011.t03894:unspliced-genomic extensin-like protein, putative| Length = 2882 Score = 28.1 bits (55), Expect(2) = 0.27 Identities = 16/73 (21%), Positives = 30/73 (41%) Frame = +2 / +2 Query: 437 WLTWSIPAVDRAVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 W +W+ P S P + + S+ S TS+ P+R R ++ + S+ Sbjct: 980 WSSWTCPGTSSPASSTSPSASSPCSSTSASPTTSSTPSRRRACRRRAARSTSTTRTTASA 1159 Query: 617 RTXXXXXRE*TSP 655 R+ R ++P Sbjct: 1160 RSDRRRRRRCSAP 1198 Score = 25.8 bits (50), Expect(2) = 0.27 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 / +2 Query: 344 PKKSLLHLSYRGRSSGDCPWRKAT 415 PK+S S S+ CPWR AT Sbjct: 827 PKRSTRSAS*TTSSTAACPWRWAT 898
>LOC_Os12g41060:12012.t03783:unspliced-genomic AP2 domain containing protein, expressed| Length = 3323 Score = 36.3 bits (73), Expect = 0.32 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +2 / +3 Query: 479 SQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPP 601 S+ P S ++ ST R + + T P+ G+T S PRP S PP Sbjct: 2736 SRAPASGSAPSTPRSTPPSPTTPSPAGSTASTPRPTSPLPP 2858
>LOC_Os03g62010:12003.t05429:unspliced-genomic harpin-induced protein, putative, expressed| Length = 1022 Score = 36.3 bits (73), Expect = 0.32 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +2 / +1 Query: 446 WSIPAVDRAVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPG 586 W P+ RA S PC +++ R TS W AR + S PR G Sbjct: 469 WPSPSTARASTSPPPCRRSTIGRGRRRRSTSRWAARASPSPSSPRRG 609
>LOC_Os01g02910:12001.t00183:unspliced-genomic glycosyltransferase, putative, expressed| Length = 3372 Score = 36.3 bits (73), Expect = 0.32 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +3 / -2 Query: 477 HHSCPVPETVCRREGSVDAHRHGRPGVERQEACRDRVRRVHPGVGPQEL 623 HH+ P E + R+ G+VDAH+H R+E G+G L Sbjct: 2864 HHAAPGEERLVRQPGAVDAHQHVARVHRRREPLHAAAAAADAGLGDHHL 2718
>LOC_Os01g49030:12001.t04345:unspliced-genomic expressed protein| Length = 1014 Score = 28.6 bits (56), Expect(2) = 0.37 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 / +3 Query: 530 CTSTWPARCGTTRSVPRPGSACPPWSGSSR 619 CT P RC + + P ++C P S + R Sbjct: 474 CTGARPGRCSRSSTWPSRSASCSPSSATCR 563 Score = 28.1 bits (55), Expect(2) = 0.37 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 / +2 Query: 264 SGNTNRCLCCCTWA*HCW 317 SG + LC C WA CW Sbjct: 44 SGKRSLTLCWCRWAWPCW 97
>LOC_Os08g02150:12008.t00112:unspliced-genomic expressed protein| Length = 1348 Score = 29.0 bits (57), Expect(2) = 0.39 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 / -1 Query: 598 WTRRTRSRHASCRSTPGRPCR 536 W+RR R R AS ++PGR R Sbjct: 811 WSRRARRRRASTGASPGRAGR 749 Score = 24.4 bits (47), Expect(2) = 0.39 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 / -1 Query: 562 RSTPGRPCRCASTEPSRRQTVSG 494 R PG C T P+RR +G Sbjct: 733 RRAPGTSSSCTGTRPTRRWCPAG 665
>LOC_Os10g26110:12010.t02026:unspliced-genomic tyrosine decarboxylase 4, putative, expressed| Length = 1787 Score = 35.9 bits (72), Expect = 0.44 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 / +2 Query: 518 RFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSRT 622 R SG + TW A R+ PR CPP +SRT Sbjct: 944 RTSGSSPTWTAAASGWRAPPRSPPRCPPTRSTSRT 1048
>LOC_Os04g33530:12004.t03029:unspliced-genomic purple acid phosphatase precursor, putative, expressed| Length = 1977 Score = 35.9 bits (72), Expect = 0.44 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +2 / +1 Query: 455 PAVDRAVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSAC 595 P+ A PS CS + ++ R T WPA + + RPGS C Sbjct: 886 PSTPPAAPSTSSCSARTPTSTRARSSTGGWPATSPPSTAARRPGSWC 1026
>LOC_Os02g10390:12002.t00887:unspliced-genomic chlorophyll a-b binding protein 8, chloroplast precursor, putative,| expressed Length = 2123 Score = 35.9 bits (72), Expect = 0.44 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 / -3 Query: 583 RSRHASCRSTPGRPCRCASTEPSRRQT 503 R R +CR PGRPCR + PS R T Sbjct: 1155 RGRGPACRGAPGRPCRRRPSSPSGR*T 1075
>LOC_Os04g46970:12004.t04224:unspliced-genomic cis-zeatin O-glucosyltransferase, putative, expressed| Length = 5077 Score = 28.6 bits (56), Expect(2) = 0.48 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 / +2 Query: 504 VCRREGSVDAHRHGRPGVERQEACRDR 584 V R G V R G PG RQE R R Sbjct: 3257 VSRARGRVHRRRRGEPGRRRQEGFRRR 3337 Score = 24.4 bits (47), Expect(2) = 0.48 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 / +1 Query: 557 GTTRSVPRPGSACPPWSGSS 616 GT RS GSA W+GS+ Sbjct: 3361 GTRRSRATSGSATSAWTGST 3420
>LOC_Os02g29530:12002.t02646:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 3588 Score = 26.7 bits (52), Expect(2) = 0.49 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 / +2 Query: 592 RRTRSRHASCRSTPGRP 542 RRTRSR C +TP P Sbjct: 725 RRTRSRTPPCSTTPSSP 775 Score = 26.3 bits (51), Expect(2) = 0.49 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 / +2 Query: 448 PCQPHQTSSAPSSFPPWAISRTSPPIT 368 P P +S PSS P + +R++PP T Sbjct: 764 PSSPTTSSPPPSSCAPPSPTRSTPPST 844
>LOC_Os10g36180:12010.t02903:unspliced-genomic expressed protein| Length = 1967 Score = 32.7 bits (65), Expect(2) = 0.50 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 / +3 Query: 512 TRRFSGCTSTWPARCGTTRSVPRPGSACPP 601 TRR WPARCG RS P P P Sbjct: 1068 TRRSPASGRPWPARCGR*RSRPAPPHQASP 1157 Score = 24.4 bits (47), Expect(2) = 0.50 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = +1 / +3 Query: 856 IVPVTGVCCHILLCRAMRA 912 I+ VCCH+ C+ ++ Sbjct: 1743 ILSCVSVCCHVYTCKCKKS 1799
>LOC_Os12g40419:12012.t03720:unspliced-genomic WAK-like kinase, putative, expressed| Length = 11427 Score = 35.4 bits (71), Expect = 0.61 Identities = 19/56 (33%), Positives = 25/56 (44%) Frame = +2 / -3 Query: 455 PAVDRAVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSRT 622 P+ R P+ P +S TR +GC P C T R+ P P PP + S T Sbjct: 7723 PSPPRRSPA*TPHRSSSRRTRMSAGCRI*APRPCPTARTGPHPSPCPPPSTSSGCT 7556
>LOC_Os09g31434:12009.t02786:unspliced-genomic expressed protein| Length = 744 Score = 35.4 bits (71), Expect = 0.61 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 / +2 Query: 509 STRRFSGCTSTWPARCGTTRSVPRPGSACPPW 604 +TR +GC+ WP RC P SA PW Sbjct: 491 TTRGAAGCSRRWPRRCAARARGAGPTSASCPW 586
>LOC_Os08g45160:12008.t04237:unspliced-genomic TENA/THI-4 family protein, expressed| Length = 4515 Score = 35.4 bits (71), Expect = 0.61 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 / +3 Query: 515 RRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSRT 622 RR SG W ARC R P + PPW SRT Sbjct: 4164 RRGSGRGRGWRARCRGRRRCRGPARSTPPWRWRSRT 4271
>LOC_Os08g45150:12008.t04236:unspliced-genomic anther-specific proline-rich protein APG precursor, putative,| expressed Length = 2336 Score = 35.4 bits (71), Expect = 0.61 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 / -3 Query: 515 RRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSRT 622 RR SG W ARC R P + PPW SRT Sbjct: 1212 RRGSGRGRGWRARCRGRRRCRGPARSTPPWRWRSRT 1105
>LOC_Os11g35330:12011.t03080:unspliced-genomic protein kinase, putative, expressed| Length = 2345 Score = 35.0 bits (70), Expect = 0.84 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -2 / -1 Query: 595 TRRTRSRHASCRSTPGRPCRCA 530 T R R R CRS+PG CRCA Sbjct: 251 TARRRRRRRCCRSSPGGRCRCA 186
>LOC_Os09g30240:12009.t02702:unspliced-genomic 6-phosphofructokinase, putative, expressed| Length = 1588 Score = 35.0 bits (70), Expect = 0.84 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 / -3 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSR 512 R R+R A+CR+ P RPC A P R Sbjct: 542 RGRTRRATCRAPPRRPCASAPPPPGR 465
>LOC_Os01g61590:12001.t05538:unspliced-genomic calcium-dependent protein kinase, isoform AK1, putative, expressed| Length = 6097 Score = 35.0 bits (70), Expect = 0.84 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +2 / +2 Query: 524 SGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 +G +ST +R TTRS P P S P W SS Sbjct: 659 AGSSSTASSRGATTRSAPPPMSPAPSWRSSS 751
>LOC_Os01g05840:12001.t00468:unspliced-genomic retinol dehydrogenase 11, putative, expressed| Length = 3307 Score = 35.0 bits (70), Expect = 0.84 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -2 / +2 Query: 577 RHASCRSTPGRPCRCASTEPSRR 509 R ASCRS+PGRP R S RR Sbjct: 311 RWASCRSSPGRPARAGSAPGPRR 379
>LOC_Os06g44100:12006.t04098:unspliced-genomic acetyltransferase, GNAT family protein, expressed| Length = 1560 Score = 29.9 bits (59), Expect(2) = 0.99 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 / -3 Query: 448 PCQPHQTSSAPSSFPPWAISRTSPP 374 P P T S+PSS P RT+PP Sbjct: 847 PATPRSTPSSPSSRAPLPSPRTTPP 773 Score = 25.8 bits (50), Expect(2) = 0.99 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = -2 / -1 Query: 592 RRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTG 488 RR R + + R C E R+ VSG G Sbjct: 1182 RRAEQRRGAAHAEAERACGVPDAEHGERRAVSGDG 1078
>LOC_Os01g57100:12001.t05118:unspliced-genomic protein kinase, putative, expressed| Length = 2503 Score = 29.9 bits (59), Expect(2) = 1.1 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 / +1 Query: 595 TRRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQL*WN 473 TRRTR+R CR R S++P R +++ + W+ Sbjct: 1780 TRRTRARRGWCRGCGSSTAREPSSKPRTRGSMASSTSSRWS 1902 Score = 26.3 bits (51), Expect(2) = 1.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 / +3 Query: 253 CQHLDYKHRPKHQQA*ASLQRQCYLP 176 C H D+ HRP +QA L+ + LP Sbjct: 1926 CAHPDHAHRPSIRQALNVLKFEAPLP 2003
>LOC_Os07g31770:12007.t02863:unspliced-genomic chalcone synthase, putative, expressed| Length = 2137 Score = 34.5 bits (69), Expect = 1.1 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 / -1 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQL*WNRPVDRR 455 R+R H + R++PG PCR + P R+ + RP RR Sbjct: 328 RSRRTHPAARTSPGSPCRWRARWPGHRRAAHAGSRGC*RRPQGRR 194
>LOC_Os05g51220:12005.t04550:unspliced-genomic aspartic proteinase nepenthesin-2 precursor, putative, expressed| Length = 1721 Score = 34.5 bits (69), Expect = 1.1 Identities = 19/63 (30%), Positives = 26/63 (41%) Frame = -2 / -1 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQL*WNRPVDRRY*PCQPHQTSSA 419 W RR+ R S RPCR A + R +T + + P R + C+P S Sbjct: 650 WARRSPPRRRSGSGAGRRPCRTARSSGGRARTGARRRRCRCRAP*ARWWRACRPRPGRST 471 Query: 418 PSS 410 P S Sbjct: 470 PRS 462
>LOC_Os04g22340:12004.t01964:unspliced-genomic SCP-like extracellular protein, expressed| Length = 549 Score = 34.5 bits (69), Expect = 1.1 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 / -3 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSRRQTVSG 494 RT R + STP PC C+S P RR+ +G Sbjct: 505 RTGRRRSRRSSTPAAPCPCSSRTPRRRRPRTG 410
>LOC_Os02g53540:12002.t04933:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3292 Score = 34.5 bits (69), Expect = 1.1 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 / +1 Query: 592 RRTRSRHASCRSTPGRPCRCA 530 RR R+RHAS R P RPCR A Sbjct: 2824 RRGRARHASGRRLPSRPCRPA 2886
>LOC_Os02g05860:12002.t00484:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2233 Score = 34.5 bits (69), Expect = 1.1 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 / +1 Query: 589 RTRSRHASCRSTPGRPCRCA 530 R+R+RHAS R P RPCR A Sbjct: 2113 RSRARHASGRRLPSRPCRVA 2172
>LOC_Os01g72049:12001.t06494:unspliced-genomic mitochondrial SBP40, putative, expressed| Length = 20678 Score = 34.5 bits (69), Expect = 1.1 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 / +2 Query: 592 RRTRSRHASCRSTPGRPCRCA 530 RR R+RHAS R P RPCR A Sbjct: 4712 RRGRARHASGRRLPSRPCRPA 4774
>LOC_Os06g49300:12006.t04614:unspliced-genomic HGA1, putative, expressed| Length = 2040 Score = 29.0 bits (57), Expect(2) = 1.2 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +3 / +2 Query: 444 HGQYRRSTGRFHHSCPVPETVCRREGSVDAHRHGRPGVER 563 HG+ RR+ R H P + E +V G PGV R Sbjct: 1613 HGRVRRAAARHEHEVPAVQHHGGGEHAVGGVPAGAPGVPR 1732 Score = 22.6 bits (43), Expect(2) = 1.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 / +2 Query: 372 IGGEVLEIAHGGKLLGADE 428 +GGE++ GG +GAD+ Sbjct: 1487 VGGELVRRDGGGARVGADQ 1543
>LOC_Os04g37970:12004.t03367:unspliced-genomic sugar transport protein 5, putative| Length = 1732 Score = 25.8 bits (50), Expect(2) = 1.2 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 / +3 Query: 383 SSGDCPWRKATGSR 424 SSG C W A+GSR Sbjct: 516 SSGGCSWGSASGSR 557 Score = 25.8 bits (50), Expect(2) = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 / +3 Query: 539 TWPARCGTTRSVPRPGSACPPWSGSS 616 T P RC + R PR + PW+ SS Sbjct: 558 TRPRRCTSPRWRPRGFAGRSPWASSS 635
>LOC_Os05g36120:12005.t03205:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 5720 Score = 30.4 bits (60), Expect(2) = 1.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 / +1 Query: 807 NTSLVRLDWRFISSFSYCARDWRVLSYSV 893 N S+ D+ + +YC R RV+SYS+ Sbjct: 1684 NRSVAIFDFEYFILHTYCVRTGRVISYSI 1770 Score = 26.7 bits (52), Expect(2) = 1.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 / +3 Query: 285 LCCCTWA*HCWNLHTK**TSPRSHCCI 365 LCCC C + ++ PRS CC+ Sbjct: 588 LCCCCCRLICCSYCSRLAMFPRSSCCV 668
>LOC_Os12g35890:12012.t03277:unspliced-genomic sarcosine oxidase, putative, expressed| Length = 1643 Score = 30.9 bits (61), Expect(2) = 1.4 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -2 / +2 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQL*WNRP 467 R R+ ++ S P R C+S P R SGTG+ * P Sbjct: 446 RRRAASSAASSRPPRRLPCSSRSPPRTAPCSGTGRR*STSP 568 Score = 24.4 bits (47), Expect(2) = 1.4 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 / +1 Query: 466 VDRRY*PCQPHQTSSAPSSFPPWAISRTS 380 +DR +* + ++S+APS+ WA R S Sbjct: 958 MDRSW*RRRAGRSSTAPSASSQWARGRAS 1044
>LOC_Os06g43780:12006.t04068:unspliced-genomic expressed protein| Length = 3234 Score = 31.3 bits (62), Expect(2) = 1.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 / -3 Query: 589 RTRSRHASCRSTPGRPCRCASTEP 518 R R + R+ PG PCRCA+ P Sbjct: 3076 RRPPRRRTRRAAPGTPCRCAAAAP 3005 Score = 24.9 bits (48), Expect(2) = 1.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -1 / -1 Query: 488 AAVMEPPCRPPVLTMSATP 432 AA PP R P + SATP Sbjct: 240 AASAPPPARTPTTSSSATP 184
>LOC_Os08g16260:12008.t01500:unspliced-genomic cytochrome P450 86A1, putative, expressed| Length = 1697 Score = 30.9 bits (61), Expect(2) = 1.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 / -2 Query: 519 GSVDAHRHGRPGVERQEACRDRVRRVHPGVG 611 G V A H RPGVERQE R V G Sbjct: 1423 GDVLAGAHPRPGVERQELVRRHVSHFPAAAG 1331 Score = 24.4 bits (47), Expect(2) = 1.4 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 / -2 Query: 844 HRFHIVPVTGVCCHIL 891 H H + + G CC+I+ Sbjct: 1090 HHRHAIAIAGACCNIV 1043 Score = 34.1 bits (68), Expect = 1.6 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -2 / +3 Query: 586 TRSRHASCRSTPGRPCRCASTEP 518 T R +SCRSTPGR C A T P Sbjct: 1356 TCRRTSSCRSTPGRGCAPARTSP 1424
>LOC_Os11g35050:12011.t03054:unspliced-genomic expressed protein| Length = 5154 Score = 34.1 bits (68), Expect = 1.6 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 / -3 Query: 485 LPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPP 601 LP S + + R S C S WP GTT PG + PP Sbjct: 223 LPPSPDRSTRRGSSSCRSPWPPWRGTTSGRTPPGPSSPP 107
>LOC_Os10g25620:12010.t01979:unspliced-genomic no apical meristem protein, expressed| Length = 2159 Score = 34.1 bits (68), Expect = 1.6 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 / -1 Query: 534 HRHGRPGVERQEACRDRVRRVHPGVGPQ 617 HR RPG RQ CR R RR PG Q Sbjct: 1379 HRRRRPGHARQLQCRQRHRRRRPGQARQ 1296
>LOC_Os08g29530:12008.t02708:unspliced-genomic RBP2 protein, putative, expressed| Length = 5099 Score = 34.1 bits (68), Expect = 1.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 / +1 Query: 445 CQPHQTSSAPSSFPPWAISRTSPP 374 C+PH+ ++ PSS PP I SPP Sbjct: 1 CKPHRPNAFPSSSPPTQIHPASPP 72
>LOC_Os08g06710:12008.t00561:unspliced-genomic expressed protein| Length = 1523 Score = 34.1 bits (68), Expect = 1.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 / +1 Query: 515 RRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSRT 622 RR +GCT+ W +R R P S+C + SR+ Sbjct: 562 RRGNGCTTRWSSRAAPPRGAPASRSSCTGRTAMSRS 669
>LOC_Os07g44410:12007.t04081:unspliced-genomic WD40-like Beta Propeller Repeat family protein, expressed| Length = 2204 Score = 34.1 bits (68), Expect = 1.6 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +2 / +3 Query: 470 AVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSR 619 A S+ S +S T GC+ P + PR GS+ PPW+ SSR Sbjct: 1125 ATSSRRRASPSSDPTAPSGGCSRGSPTCSTRRGAPPRAGSSSPPWAPSSR 1274
>LOC_Os06g33350:12006.t03032:unspliced-genomic expressed protein| Length = 3481 Score = 34.1 bits (68), Expect = 1.6 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 / +2 Query: 546 RPGVERQEACRDRVRRVHPG 605 R GVER+E+C+D RR PG Sbjct: 1334 RHGVEREESCQDEARRAWPG 1393
>LOC_Os04g38540:12004.t03425:unspliced-genomic aldose 1-epimerase, putative, expressed| Length = 3175 Score = 34.1 bits (68), Expect = 1.6 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +2 / -2 Query: 491 CS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACP 598 CS + T + + T PAR T R PRP SACP Sbjct: 2691 CSASCRCTAAWPAGSPTAPARGPTRRPAPRPPSACP 2584
>LOC_Os03g19452:12003.t01710:unspliced-genomic expressed protein| Length = 5077 Score = 34.1 bits (68), Expect = 1.6 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 / +3 Query: 503 SLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 S STRR C+S+ P C +R+ P P + P + SS Sbjct: 477 SPSTRRGGACSSSTPTGCRGSRTPPSPRTTSPRGAASS 590
>LOC_Os03g16760:12003.t01458:unspliced-genomic protein phosphatase 2C containing protein, expressed| Length = 3530 Score = 34.1 bits (68), Expect = 1.6 Identities = 20/56 (35%), Positives = 24/56 (42%) Frame = +2 / +2 Query: 533 TSTWPARCGTTRSVPRPGSACPPWSGSSRTXXXXXRE*TSPLISIGSDNGVRDSSS 700 TS RC TT S P GS+C +GS+ T SP S R S+S Sbjct: 2603 TSAARRRCATTGSAPTTGSSCCLLTGSTSTSPTRRWSIRSPCSPPSSPTATRRSTS 2770
>LOC_Os02g32990:12002.t02942:unspliced-genomic expressed protein| Length = 993 Score = 34.1 bits (68), Expect = 1.6 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 / +1 Query: 445 CQPHQTSSAPSSFPPWAISRTSPP 374 C P T S+PS+ PP A RT+PP Sbjct: 649 CSPPATPSSPSAPPPRAARRTAPP 720
>LOC_Os02g05190:12002.t00417:unspliced-genomic expressed protein| Length = 1192 Score = 34.1 bits (68), Expect = 1.6 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +2 / -1 Query: 467 RAVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTR 568 RA PS+ PCS RR + W RCGT R Sbjct: 670 RAAPSRRPCSKRRSPCRRSRRRSCGWTPRCGTRR 569
>LOC_Os01g48130:12001.t04258:unspliced-genomic ANAC010, putative, expressed| Length = 4674 Score = 34.1 bits (68), Expect = 1.6 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 / +2 Query: 509 STRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSRT 622 STRR C STW R G TR P S +RT Sbjct: 500 STRRTRSCWSTWKGRRGLTRGSSTPSSTSSSPPSRART 613
>LOC_Os01g45990:12001.t04051:unspliced-genomic potassium channel AKT1, putative, expressed| Length = 6458 Score = 34.1 bits (68), Expect = 1.6 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +2 / -3 Query: 515 RRFSGCTSTWPARCGTTRSVPRPGSACPPW 604 RR G S+ ARC T+RSV P PPW Sbjct: 5697 RRLRGSCSSSWARC*TSRSVMPPPPPAPPW 5608
>LOC_Os05g08540:12005.t00733:unspliced-genomic gibberellin 3-beta-dioxygenase 2-2, putative, expressed| Length = 1928 Score = 33.1 bits (66), Expect(2) = 1.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 / -3 Query: 509 TNCFRNRAAVMEPPCRPPVLTMSATP 432 + C R RAA PCRPP +A P Sbjct: 453 SRCSRRRAAAPRAPCRPPAARTAAPP 376 Score = 22.1 bits (42), Expect(2) = 1.6 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -1 / -3 Query: 644 IHDDDDDEFLRTHSRVDTPNPVAARFLSFH 555 I DDDD+ R +R PVA + H Sbjct: 1413 IADDDDERPRRPRNRHPPVRPVAEQLQPRH 1324
>LOC_Os05g13320:12005.t01110:unspliced-genomic C4-dicarboxylate transporter/malic acid transport protein, expressed| Length = 2358 Score = 28.6 bits (56), Expect(2) = 1.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 / +3 Query: 524 SGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 S C + W RC T S R C WS S Sbjct: 1296 SACRTPWRRRCCRTGSGTRSWRPCCAWSSRS 1388 Score = 22.6 bits (43), Expect(2) = 1.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 / +3 Query: 389 GDCPWRKATGSR 424 G CPWR SR Sbjct: 1146 GACPWRSCAPSR 1181
>LOC_Os01g14110:12001.t01270:unspliced-genomic expressed protein| Length = 1463 Score = 29.5 bits (58), Expect(2) = 1.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 / +3 Query: 448 PCQPHQTSSAPSSFPPWAISRTSPPITQ 365 PC P T S P S P SR PP T+ Sbjct: 849 PCAPSPTRSPPRSSPRQLRSRRRPPPTR 932 Score = 25.4 bits (49), Expect(2) = 1.7 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / +1 Query: 582 GRGTLLVVPHRAGHVDVHP 526 GRG L HRAG V+V P Sbjct: 484 GRGGLGAGAHRAGAVEVEP 540
>LOC_Os09g28620:12009.t02540:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1505 Score = 28.6 bits (56), Expect(2) = 1.7 Identities = 18/42 (42%), Positives = 20/42 (47%) Frame = +2 / +1 Query: 374 RGRSSGDCPWRKATGSR*SLVWLTWSIPAVDRAVPSQLPCS* 499 RGR S P RK GS + L S PA A S+ CS* Sbjct: 634 RGRRSSGRPRRKTDGSPSTATRLASSSPATAPAPTSRTRCS* 759 Score = 22.6 bits (43), Expect(2) = 1.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +1 Query: 545 PARCGTTRSVPRP 583 P RCGTTR+ P Sbjct: 871 PRRCGTTRARAPP 909
>LOC_Os09g27320:12009.t02411:unspliced-genomic zinc finger protein, putative| Length = 960 Score = 27.2 bits (53), Expect(2) = 1.7 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = -2 / +1 Query: 457 RY*PCQPHQTSSAPSSFPPWAISRTSPP 374 R+ P PH P +P W+ PP Sbjct: 457 RFGPSPPHMAPPPPPPYPSWSNHHHLPP 540 Score = 24.0 bits (46), Expect(2) = 1.7 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 / +3 Query: 592 RRTRSRHASCRSTPGRPC 539 R RH R+ PG PC Sbjct: 378 RAVPERHGHARALPGLPC 431
>LOC_Os09g31300:12009.t02771:unspliced-genomic helix-loop-helix DNA-binding domain containing protein, expressed| Length = 3010 Score = 29.5 bits (58), Expect(2) = 1.8 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 / -2 Query: 530 CTSTWPARCGTTRSVPRPGSACPPWSGSSRT 622 CT+ PA S PR + PW+ + RT Sbjct: 450 CTAASPASSSAAASAPRLAAGSGPWTPARRT 358 Score = 26.3 bits (51), Expect(2) = 1.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 / -2 Query: 359 LHLSYRGRSSGDCPWRKATGSR 424 + + +RGR + CPW GSR Sbjct: 897 IKVEWRGRCTNRCPW*DG*GSR 832
>LOC_Os07g11000:12007.t00974:unspliced-genomic expressed protein| Length = 8470 Score = 29.9 bits (59), Expect(2) = 1.8 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 / -1 Query: 460 RRY*PCQPHQTSSAPSSFPPWAISRTSPP 374 RR P +P + A PPW R SPP Sbjct: 115 RRRPPARPTPRAGATPPGPPWCTPRPSPP 29 Score = 27.2 bits (53), Expect(2) = 1.8 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -2 / -3 Query: 595 TRRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQ 485 T R RSR SCR R A+T P+ +G+ Sbjct: 7820 TARGRSRGRSCRPARSPGTRSATTSPAPAAATPASGR 7710
>LOC_Os06g13220:12006.t01197:unspliced-genomic growth regulator, putative, expressed| Length = 10085 Score = 25.8 bits (50), Expect(2) = 2.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 / +3 Query: 494 NRAAVMEPPCRPPVLTMSATP 432 N ++PPC PPV +++ P Sbjct: 6456 NPVPSLKPPCTPPVRSIAPPP 6518 Score = 24.9 bits (48), Expect(2) = 2.0 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 / +1 Query: 430 TSSAPSSFPPWAISRTSPP 374 TSS S PP A R+SPP Sbjct: 6574 TSSRSPSTPPAASRRSSPP 6630
>LOC_Os02g51030:12002.t04687:unspliced-genomic S-adenosylmethionine-dependent methyltransferase/ methyltransferase,| putative, expressed Length = 2472 Score = 30.4 bits (60), Expect(2) = 2.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 / +3 Query: 797 HVIEHFPCQIRLAFHFIVFILC 862 H+IE R+ HFI+F+LC Sbjct: 1620 HIIEQGNMMCRILLHFILFVLC 1685 Score = 24.9 bits (48), Expect(2) = 2.0 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 / +3 Query: 276 NRCLCCCTWA*HCW 317 ++ LC C W *H W Sbjct: 1068 SQVLCKCRWR*HSW 1109
>LOC_Os10g36924:12010.t02967:unspliced-genomic aquaporin NIP5.1, putative, expressed| Length = 7104 Score = 26.3 bits (51), Expect(2) = 2.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 / +1 Query: 595 TRRTRSRHASCRSTPGRPCRCASTEPSR 512 T RS S RS R CR T PSR Sbjct: 5437 TSTRRSPSPSPRSATSRGCRSRRTSPSR 5520 Score = 24.4 bits (47), Expect(2) = 2.0 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 / +1 Query: 448 PCQPHQTSSAPSSFPPWAISRTSPP 374 P P S+PSS P S +SPP Sbjct: 5602 PPSPPPRPSSPSSSSPSTSSSSSPP 5676
>LOC_Os08g29340:12008.t02689:unspliced-genomic ligA, putative| Length = 1921 Score = 33.1 bits (66), Expect(2) = 2.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 / -3 Query: 530 CTSTWPARCGTTRSVPRPGSACPPWSGSSR 619 C WPA S PRP CPP G+ R Sbjct: 155 CPRPWPAAIAIGPSWPRPPRPCPPAGGAWR 66 Score = 21.7 bits (41), Expect(2) = 2.2 Identities = 5/12 (41%), Positives = 8/12 (66%) Frame = +3 / -3 Query: 69 SWSRGSLYCCCL 104 +W R +CCC+ Sbjct: 392 AWPRPRWWCCCV 357
>LOC_Os12g43660:12012.t04035:unspliced-genomic receptor-like protein kinase 5 precursor, putative, expressed| Length = 3767 Score = 33.6 bits (67), Expect = 2.2 Identities = 18/59 (30%), Positives = 24/59 (40%) Frame = +2 / +3 Query: 530 CTSTWPARCGTTRSVPRPGSACPPWSGSSRTXXXXXRE*TSPLISIGSDNGVRDSSSAP 706 CTST P TRS G A W+G T SP + S + ++S+P Sbjct: 2436 CTSTCPTATYGTRSTAAAGGASASWTGRRATASRSASPRASPTSTTTSSSPSSTATSSP 2612
>LOC_Os12g09850:12012.t00864:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3138 Score = 33.6 bits (67), Expect = 2.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 / +3 Query: 589 RTRSRHASCRSTPGRPCRCA 530 R R+RHAS R P RPCR A Sbjct: 2673 RGRARHASGRRLPSRPCRAA 2732
>LOC_Os11g30540:12011.t02657:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2833 Score = 33.6 bits (67), Expect = 2.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 / +1 Query: 589 RTRSRHASCRSTPGRPCRCA 530 R R+RHAS R P RPCR A Sbjct: 2671 RGRARHASGRRLPSRPCRAA 2730
>LOC_Os10g28460:12010.t02198:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3241 Score = 33.6 bits (67), Expect = 2.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 / +3 Query: 589 RTRSRHASCRSTPGRPCRCA 530 R R+RHAS R P RPCR A Sbjct: 2775 RGRARHASGRRLPSRPCRAA 2834
>LOC_Os09g29050:12009.t02583:unspliced-genomic mitochondrial 2-oxoglutarate/malate carrier protein, putative| Length = 966 Score = 33.6 bits (67), Expect = 2.2 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +2 / +2 Query: 467 RAVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSAC 595 R P + PC+ S + R GC+ C RS PRP C Sbjct: 188 RVGPGRSPCARRSSARRGQPGCSPACRRPCCGRRSTPRPAWGC 316
>LOC_Os08g43430:12008.t04068:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1661 Score = 33.6 bits (67), Expect = 2.2 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 / +1 Query: 583 RSRHASCRSTPGRPCRCASTEPS 515 RS A+CRSTP P R AST P+ Sbjct: 181 RSSPATCRSTPPSPRRSASTSPT 249
>LOC_Os06g44620:12006.t04149:unspliced-genomic 4-coumarate--CoA ligase 1, putative, expressed| Length = 6796 Score = 33.6 bits (67), Expect = 2.2 Identities = 18/61 (29%), Positives = 25/61 (40%) Frame = -2 / +3 Query: 583 RSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQL*WNRPVDRRY*PCQPHQTSSAPSSFP 404 R+R C +P S SG+G+ W RP R + T+S+PS P Sbjct: 558 RARWRRCAGSPPTAASPWSPSTGTSTAASGSGRRCWTRPSSRSTPTRRSTPTTSSPSLTP 737 Query: 403 P 401 P Sbjct: 738 P 740
>LOC_Os06g43430:12006.t04033:unspliced-genomic cytochrome P450 71D10, putative, expressed| Length = 2146 Score = 33.6 bits (67), Expect = 2.2 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 / -2 Query: 592 RRTRSRHASCRSTPGRPCRCAST 524 RR RSR A C S P R CRC T Sbjct: 273 RRARSRMAWCGSAPARWCRCPIT 205
>LOC_Os04g13160:12004.t01137:unspliced-genomic ribosomal RNA apurinic site specific lyase, putative, expressed| Length = 2206 Score = 33.6 bits (67), Expect = 2.2 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 / +2 Query: 467 RAVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPP 601 R S PC + TR SG +++ PA ++R+ R GS C P Sbjct: 485 RHAASPTPCPASWARTRARSGASTSRPAAWRSSRACSRTGSRCSP 619
>LOC_Os03g06270:12003.t00496:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3136 Score = 33.6 bits (67), Expect = 2.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 / +1 Query: 589 RTRSRHASCRSTPGRPCRCA 530 R R+RHAS R P RPCR A Sbjct: 2671 RGRARHASGRRLPSRPCRAA 2730
>LOC_Os02g41860:12002.t03773:unspliced-genomic aquaporin PIP2.2, putative, expressed| Length = 3744 Score = 33.6 bits (67), Expect = 2.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 / +3 Query: 509 STRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 S+RR S CTS WP GT+ S P + P + +S Sbjct: 213 SSRRSSSCTSRWPP*SGTSTSRTPPSTPPTPPAAAS 320
>LOC_Os02g14430:12002.t01238:unspliced-genomic peroxidase 68 precursor, putative, expressed| Length = 1434 Score = 33.6 bits (67), Expect = 2.2 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 / +1 Query: 467 RAVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPW 604 R P+ P + + STR + +S+ PA S P P + PPW Sbjct: 421 RRSPTSTPSAATTSSTRSSATSSSSAPASSPAPTSSPSPPATAPPW 558
>LOC_Os01g63290:12001.t05698:unspliced-genomic sialin, putative, expressed| Length = 8085 Score = 33.6 bits (67), Expect = 2.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 / -1 Query: 518 RFSGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 R S C +W + +TRS PRP S+ + SS Sbjct: 3804 RGSSCGGSWTSTAASTRSTPRPSSSSTTTAASS 3706
>LOC_Os01g61650:12001.t05543:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3137 Score = 33.6 bits (67), Expect = 2.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 / +2 Query: 589 RTRSRHASCRSTPGRPCRCA 530 R R+RHAS R P RPCR A Sbjct: 2672 RGRARHASGRRLPSRPCRAA 2731
>LOC_Os01g32780:12001.t02850:unspliced-genomic ethylene-responsive protein, putative, expressed| Length = 2937 Score = 33.6 bits (67), Expect = 2.2 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 / +3 Query: 518 RFSGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 R S T+ W RC T+R R +C P S SS Sbjct: 315 RASSATTRWSGRCATSRRPSRRRCSCSPCSRSS 413
>LOC_Os07g11830:12007.t01056:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2852 Score = 26.3 bits (51), Expect(2) = 2.2 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 / -1 Query: 497 RNRAAVMEPPCRPPVLTMSATP 432 R RAAV PP P+ +S TP Sbjct: 242 RCRAAVASPPLHRPLSLLSLTP 177 Score = 24.4 bits (47), Expect(2) = 2.2 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 / -3 Query: 439 PHQTSSAPSSFPPWAISRTSPP 374 P SS P FPP + T+PP Sbjct: 168 PQPFSSPPHPFPPISSLFTTPP 103
>LOC_Os02g08400:12002.t00736:unspliced-genomic HLS1, putative, expressed| Length = 1599 Score = 32.2 bits (64), Expect(2) = 2.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 / +2 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQ 485 W RR R+R S S G RC+ + S +GTG+ Sbjct: 812 WRRRRRTRRRSRCSRAGSSTRCSGSRGSSATPCTGTGR 925 Score = 22.1 bits (42), Expect(2) = 2.5 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -2 / +2 Query: 475 NRPVDRRY*PCQPHQTSSAPSSFPPWAISRTSPP 374 +RP R PC+ S A + SR SPP Sbjct: 1406 SRPTTRPPPPCRTGDASHATRTSGASRKSRPSPP 1507
>LOC_Os01g70880:12001.t06386:unspliced-genomic nuclear transcription factor Y subunit B-3, putative| Length = 435 Score = 26.7 bits (52), Expect(2) = 2.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 / -3 Query: 374 RGRSSGDCPWRKATG 418 RG S+G C WR+ +G Sbjct: 277 RGTSAGTCAWRRRSG 233 Score = 24.0 bits (46), Expect(2) = 2.5 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +2 / -3 Query: 533 TSTWPARCGTTRSVPRPGSACPPWSGSS 616 +S WPA + + RP + P W ++ Sbjct: 106 SSPWPASISSPAAAARPS*SGPRWRSAA 23
>LOC_Os05g31360:12005.t02733:unspliced-genomic hypothetical protein| Length = 426 Score = 26.7 bits (52), Expect(2) = 2.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 / -3 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSRRQTVSGT 491 R R R C S P S P RRQ +GT Sbjct: 334 RRRRRGRRCNSAHR*PASGTSRRPGRRQWTAGT 236 Score = 24.0 bits (46), Expect(2) = 2.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 / -3 Query: 427 SSAPSSFPPWAISRTSPP 374 + +P PPW RT PP Sbjct: 163 AGSPPPPPPWLPRRTRPP 110
>LOC_Os08g16190:12008.t01493:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3424 Score = 30.9 bits (61), Expect(2) = 2.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 / -2 Query: 3 EV*HGRLCGSVWCSKSFGPNQASW 74 E+ G CG++ S SFGP + SW Sbjct: 1656 EITRGS*CGNITPSASFGPKEISW 1585 Score = 24.4 bits (47), Expect(2) = 2.7 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +3 / -3 Query: 432 WCG*HGQYRRSTGRFHHSCPVPETVCRREG 521 WC + RRS G F SC + C G Sbjct: 1322 WCAKSVRERRSRGLFGPSCGLAADGCSLAG 1233
>LOC_Os12g05550:12012.t00443:unspliced-genomic sialyltransferase-like protein, putative, expressed| Length = 1579 Score = 33.1 bits (66), Expect = 3.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 / +3 Query: 542 WPARCGTTRSVPRPGSACPPWSGSS 616 WPA C T+R G+ PWSG++ Sbjct: 573 WPA*CATSRGSSAAGTGPAPWSGTA 647
>LOC_Os11g25740:12011.t02190:unspliced-genomic hypothetical protein| Length = 444 Score = 33.1 bits (66), Expect = 3.0 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = -1 / -2 Query: 593 TPNPVAARFLSFHTGPAMSMCIH*TFSSTNCFRNRAAVMEPPCRPPVLT 447 TP P A+ T +S C+ F +T+C + PCR P T Sbjct: 209 TPEPPASPSTRAATACVVSGCLLPAFPATSCRTTASTTFATPCRTPAAT 63
>LOC_Os10g30620:12010.t02394:unspliced-genomic conserved hypothetical protein| Length = 4095 Score = 33.1 bits (66), Expect = 3.0 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +2 / +2 Query: 503 SLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 S STRR GC+S+ P C + + P P ++ P + SS Sbjct: 353 SPSTRRGGGCSSSTPTGCRGSGTPPWPRTSSPRGAASS 466
>LOC_Os10g25487:12010.t01965:unspliced-genomic NBS-LRR disease resistance protein, putative, expressed| Length = 12351 Score = 33.1 bits (66), Expect = 3.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 / +3 Query: 524 SGCTSTWPARCGTTRSVPRPGSACPPWSGSSR 619 +G S+WP R G T +PR + C GSSR Sbjct: 1431 AGSRSSWPTRRGGTSPMPRKENMCMSG*GSSR 1526
>LOC_Os09g32620:12009.t02876:unspliced-genomic chloroplastic quinone-oxidoreductase, putative, expressed| Length = 1499 Score = 33.1 bits (66), Expect = 3.0 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 / -3 Query: 545 PARCGTTRSVPRPGSACPPWSGSSR 619 PAR G RS PR ++CP SG+ R Sbjct: 1230 PARGGAARSAPRRRTSCPTGSGARR 1156
>LOC_Os07g49330:12007.t04561:unspliced-genomic phosphoinositide-specific phospholipase C, putative, expressed| Length = 3157 Score = 33.1 bits (66), Expect = 3.0 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +2 / +3 Query: 479 SQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 S P S* S CT+TWP R TT S P P S ++ Sbjct: 603 SSSPTS*THPSGTGRGRCTTTWPPRSPTTSSTPATTPTSPATSSAA 740
>LOC_Os07g33850:12007.t03062:unspliced-genomic septum-promoting GTP-binding protein 1, putative, expressed| Length = 3729 Score = 33.1 bits (66), Expect = 3.0 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +2 / +1 Query: 845 IVFILCP*LACVVIFCCVVQC 907 I F++C L C++ FCCV++C Sbjct: 1213 IFFLVCLNLLCLMSFCCVMEC 1275
>LOC_Os04g44400:12004.t03980:unspliced-genomic ATP-dependent Clp protease proteolytic subunit, mitochondrial| precursor, putative, expressed Length = 1224 Score = 33.1 bits (66), Expect = 3.0 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -2 / -1 Query: 556 TPGRPCRCASTEPSRRQTVSGTGQL*WNRPVDRRY*P 446 +P R RC + P+RR T G+ + W P RR P Sbjct: 747 SPWRGWRCRTPAPTRRPTAGGS*RARWGAPAARRARP 637
>LOC_Os04g03980:12004.t00286:unspliced-genomic disulfide oxidoreductase/ monooxygenase/ oxidoreductase, putative,| expressed Length = 2124 Score = 33.1 bits (66), Expect = 3.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 / -3 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSRR 509 RTR R SCR TP R C P RR Sbjct: 709 RTRRRAPSCRGTPRRTCSRRRAPPRRR 629
>LOC_Os03g21100:12003.t01866:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3219 Score = 33.1 bits (66), Expect = 3.0 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +3 / +2 Query: 480 HSCPVPETVCRREGSVDAHRHGRPGVERQEACRDR 584 H CP V + +G V HR R QE CR R Sbjct: 1514 HGCPRNHQVSKCDGLVHCHRA*RKDAHHQEICRGR 1618
>LOC_Os03g14700:12003.t01257:unspliced-genomic lipid binding protein, putative| Length = 4816 Score = 33.1 bits (66), Expect = 3.0 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 / +2 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGT 491 W R+RSR S ++P R C S + SRR+ S T Sbjct: 3908 WCARSRSRTRS*SASPTRTWCCTSAQCSRRRPASST 4015
>LOC_Os03g11980:12003.t00999:unspliced-genomic beta-hexosaminidase beta chain precursor, putative, expressed| Length = 2578 Score = 33.1 bits (66), Expect = 3.0 Identities = 17/51 (33%), Positives = 21/51 (41%) Frame = -2 / -3 Query: 541 CRCASTEPSRRQTVSGTGQL*WNRPVDRRY*PCQPHQTSSAPSSFPPWAIS 389 CRC T R S T W RR C P + S++ + PWA S Sbjct: 1565 CRCPPTRRGRSPGSSTTPTTRWRGSPRRRRASCSPARRSTSAVWWSPWAES 1413
>LOC_Os03g11020:12003.t00903:unspliced-genomic expressed protein| Length = 2068 Score = 33.1 bits (66), Expect = 3.0 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +3 / +1 Query: 531 AHRHGRPGVERQEACRDRVRRVHP 602 AHRHGRP RQ R R RR+ P Sbjct: 490 AHRHGRPRPRRQGLLRPRDRRLLP 561
>LOC_Os02g53130:12002.t04892:unspliced-genomic nitrate reductase, putative, expressed| Length = 3417 Score = 33.1 bits (66), Expect = 3.0 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -2 / +3 Query: 595 TRRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGT 491 TRR+ AS RSTP R CR + S R+ S T Sbjct: 372 TRRSSGSPASTRSTPSRRCRASCRTASSRRRRSTT 476
>LOC_Os02g48180:12002.t04402:unspliced-genomic expressed protein| Length = 12247 Score = 33.1 bits (66), Expect = 3.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 / -3 Query: 477 HHSCPVPETVCRREGSVDAHR 539 HH C P V RR+G +D HR Sbjct: 344 HHECQRPAPVLRRDGGLDLHR 282
>LOC_Os02g33710:12002.t03012:unspliced-genomic histidine decarboxylase, putative, expressed| Length = 3115 Score = 33.1 bits (66), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 / +2 Query: 563 TRSVPRPGSACPPWSGSSRT 622 TR+ RPGS PPW SSR+ Sbjct: 221 TRTTRRPGSGRPPWPASSRS 280
>LOC_Os02g30200:12002.t02713:unspliced-genomic PE-PGRS family protein, putative| Length = 5327 Score = 33.1 bits (66), Expect = 3.0 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 / +3 Query: 528 DAHRHGRPGVERQEACRDRVRRVHPGVG 611 DA HGR G R R R+ RV GVG Sbjct: 2481 DAQHHGRRGARRDRRRRQRLGRVDQGVG 2564
>LOC_Os02g15500:12002.t01343:unspliced-genomic expressed protein| Length = 1393 Score = 33.1 bits (66), Expect = 3.0 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = -2 / -3 Query: 538 RCASTEPSRRQTVSGTGQL*WNRPVDRRY*PCQPHQTSSAPSSFPPWAISRTS 380 RC++ +R ++ SGT W + RR+ C ++SS P + P SR S Sbjct: 266 RCSTARTARMKSESGTVAARWRKWRRRRHLCCSMARSSSRPR*YGPMDTSRGS 108
>LOC_Os01g69070:12001.t06261:unspliced-genomic auxin efflux carrier component 6, putative, expressed| Length = 6539 Score = 33.1 bits (66), Expect = 3.0 Identities = 19/42 (45%), Positives = 21/42 (50%) Frame = +2 / +3 Query: 491 CS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 CS S S R SGCTST P R RP + PP + SS Sbjct: 708 CSSCSRSGRPPSGCTSTAPRRRRRPARTSRPPAPPPPQARSS 833
>LOC_Os01g61690:12001.t05547:unspliced-genomic virulence-related protein Nf314, putative, expressed| Length = 3631 Score = 33.1 bits (66), Expect = 3.0 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -2 / +2 Query: 580 SRHASCRSTPGRPCRCASTEPSRRQTVSGTG 488 SR +SC ST GR R + T RR SG+G Sbjct: 863 SRRSSCGSTAGRGARRSGTARRRRSARSGSG 955
>LOC_Os01g46430:12001.t04094:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 1719 Score = 33.1 bits (66), Expect = 3.0 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 / +2 Query: 476 PSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSAC 595 P+ S ++ STRR S T W AR G T PR + C Sbjct: 908 PAAACTSSSTASTRRSSSRTRRWAARSGRTSGCPRAPTWC 1027
>LOC_Os02g20560:12002.t01848:unspliced-genomic fasciclin-like arabinogalactan protein 10 precursor, putative,| expressed Length = 1345 Score = 25.4 bits (49), Expect(2) = 3.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 / +3 Query: 475 NRPVDRRY*PCQPHQTSSAPSSFPP 401 +RP R P P +SAPS+ PP Sbjct: 441 SRPPPTRCAPRPPASAASAPSTSPP 515 Score = 24.9 bits (48), Expect(2) = 3.1 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = -2 / +3 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRR 509 WTRR R S+PG S P R Sbjct: 372 WTRRRRRSWCCTTSSPGTTASSRSRPPPTR 461
>LOC_Os01g09340:12001.t00812:unspliced-genomic hypothetical protein| Length = 2973 Score = 27.2 bits (53), Expect(3) = 3.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +3 / -3 Query: 24 CGSVWCSKSFGPNQASWSRGSLYCCC 101 C WC S +A+ SR CCC Sbjct: 613 CAGGWCLPSSSRKRAAASRRGGGCCC 536 Score = 23.5 bits (45), Expect(3) = 3.2 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +2 / -1 Query: 524 SGCTSTWPARCGTTRSVPRPGSACP 598 +GC P G + + P G+ CP Sbjct: 111 TGCVGPGPRTVGRSLAPPVAGNPCP 37 Score = 23.1 bits (44), Expect(3) = 3.2 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = +3 / -3 Query: 282 CLCCCTW 302 C CCC W Sbjct: 544 CCCCCGW 524
>LOC_Os03g42590:12003.t03662:unspliced-genomic hypothetical protein| Length = 687 Score = 27.6 bits (54), Expect(2) = 3.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -2 / -2 Query: 565 CRSTPGRPCRCASTEPSR 512 CRS P PCRC P R Sbjct: 302 CRSQPLPPCRCRRWPPCR 249 Score = 22.6 bits (43), Expect(2) = 3.2 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = -1 / -2 Query: 473 PPCRPPV 453 PPCRPP+ Sbjct: 260 PPCRPPL 240
>LOC_Os08g43180:12008.t04043:unspliced-genomic expressed protein| Length = 3397 Score = 28.1 bits (55), Expect(2) = 3.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 / +2 Query: 598 WTRRTRSRHASCRSTPGRP 542 W RRT S RSTPG P Sbjct: 821 WRRRTPSSSPRSRSTPGSP 877 Score = 26.7 bits (52), Expect(2) = 3.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 / +2 Query: 427 SSAPSSFPPWAISRTSPP 374 S++P++ PW RT PP Sbjct: 1166 STSPTTSTPWCARRTGPP 1219
>LOC_Os12g30990:12012.t02805:unspliced-genomic F-box domain containing protein| Length = 939 Score = 32.7 bits (65), Expect = 4.1 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -2 / -3 Query: 592 RRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQ 485 R R R+ P PCRC+ + RR T + TG+ Sbjct: 334 RSRRCSSRPWRAPPPSPCRCSRSPGRRRSTTAATGR 227
>LOC_Os10g35940:12010.t02882:unspliced-genomic ATDFB, putative, expressed| Length = 5263 Score = 32.7 bits (65), Expect = 4.1 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 / +2 Query: 863 P*LACVVIFCCVVQCEPALNCSLFE 937 P C+V++CC +C P + C+ E Sbjct: 5090 PGSVCLVVYCCSEECHPIVECTNIE 5164
>LOC_Os08g25070:12008.t02276:unspliced-genomic PME/invertase inhibitor-like protein, putative, expressed| Length = 670 Score = 32.7 bits (65), Expect = 4.1 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -2 / -2 Query: 586 TRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQL*WNRPVDRR 455 T S +CR +P R R AS R + G W RP RR Sbjct: 474 TTSPRRACRPSPPRRSRAASARCRRTAPGTTAGTAPWRRPPSRR 343
>LOC_Os07g42270:12007.t03881:unspliced-genomic conserved hypothetical protein| Length = 825 Score = 32.7 bits (65), Expect = 4.1 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -1 / +3 Query: 470 PCRPPVLTMSATPDFICSQ*LSSMGNLQNFSPDNSDAAVTSWASSS 333 P PP A+ + Q +++ + QN P DAAV W + S Sbjct: 516 PATPPCSATGASSSSVSRQVVTAQTHRQNSPPSYQDAAVRRWGTGS 653
>LOC_Os07g36130:12007.t03285:unspliced-genomic histone H2A.2, putative, expressed| Length = 1157 Score = 32.7 bits (65), Expect = 4.1 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 / +1 Query: 509 STRRFSGCTSTWPARCGTTRSVPRPGSACP 598 +TRR + C +T +RC TTRS P +A P Sbjct: 646 TTRRPASCRATSSSRCATTRS*PSCSAAPP 735
>LOC_Os06g11400:12006.t01017:unspliced-genomic threonine endopeptidase, putative, expressed| Length = 2654 Score = 32.7 bits (65), Expect = 4.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 / +1 Query: 516 EGSVDAHRHGRPGVERQEACRDRVRRVHPGVGP 614 EG +A RHGRP + ++ R R R+V P P Sbjct: 97 EGEEEAERHGRPRLHQRLRHRHRRRQVSPPARP 195
>LOC_Os05g12770:12005.t01103:unspliced-genomic NB-ARC domain containing protein| Length = 4633 Score = 32.7 bits (65), Expect = 4.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 / -2 Query: 495 EQGSCDGTALSTAGIDHVSHTRLHLLPVAFLHGQS 391 E+ S G AL+ + H+SH +HL P+ F G + Sbjct: 3939 ERPSRTGIALTCSSQSHISHLGIHLKPIVFSLGNA 3835
>LOC_Os05g05990:12005.t00489:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 4634 Score = 32.7 bits (65), Expect = 4.1 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 / -1 Query: 533 TSTWPARCGTTRSVPRPGSACPPWSGSSRT 622 +STWP+RCG S P P A P R+ Sbjct: 248 SSTWPSRCG*ASSTPIPLEAKPATKAERRS 159
>LOC_Os04g20340:12004.t01772:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2491 Score = 32.7 bits (65), Expect = 4.1 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 / +1 Query: 592 RRTRSRHASCRSTPGRPCRCA 530 RR R+RHAS R P RPC+ A Sbjct: 2023 RRGRARHASGRRLPSRPCQPA 2085
>LOC_Os04g09780:12004.t00812:unspliced-genomic ATP binding protein, putative| Length = 1016 Score = 32.7 bits (65), Expect = 4.1 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -2 / -2 Query: 592 RRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQL*WNRP 467 RR RS CR+ PC A RR+T +G+ W RP Sbjct: 460 RRRRSSCWGCRTRTPGPCPAAPGTARRRRTGAGSCCTAWRRP 335
>LOC_Os03g62140:12003.t05441:unspliced-genomic dnaJ domain containing protein| Length = 864 Score = 32.7 bits (65), Expect = 4.1 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -2 / +2 Query: 592 RRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTG 488 R SRH+ TP P RC P QT + +G Sbjct: 113 RSASSRHSLASPTPSPPTRCTPPPPPPAQTAAASG 217
>LOC_Os03g48810:12003.t04233:unspliced-genomic permease 1, putative, expressed| Length = 3592 Score = 32.7 bits (65), Expect = 4.1 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 / -3 Query: 565 CRSTPGRPCRCASTEPSRR 509 C STPGRP RCA + RR Sbjct: 3230 CPSTPGRPSRCACSPGGRR 3174
>LOC_Os02g51150:12002.t04699:unspliced-genomic protein SUR2, putative, expressed| Length = 2388 Score = 32.7 bits (65), Expect = 4.1 Identities = 21/61 (34%), Positives = 24/61 (39%) Frame = +2 / +3 Query: 527 GCTSTWPARCGTTRSVPRPGSACPPWSGSSRTXXXXXRE*TSPLISIGSDNGVRDSSSAP 706 GCTS W A G T + PG PP + S + P S R SSS P Sbjct: 387 GCTSRWTAWSGWTCTGCTPGRRRPPRTSSPGAPSSGASSSSRPSRSPSRSPSSR*SSSPP 566 Query: 707 V 709 V Sbjct: 567 V 569
>LOC_Os02g18690:12002.t01662:unspliced-genomic BURP domain containing protein, expressed| Length = 4740 Score = 32.7 bits (65), Expect = 4.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 / +3 Query: 595 TRRTRSRHASCRSTPGRPCRCASTEPSRRQ 506 TR T R S TP PC +S +P+RR+ Sbjct: 3984 TRATPCRSTSAPWTPSSPCSASSLDPTRRR 4073
>LOC_Os02g15110:12002.t01304:unspliced-genomic RING-H2 finger protein ATL5H precursor, putative, expressed| Length = 501 Score = 32.7 bits (65), Expect = 4.1 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 / -3 Query: 515 RRFSGCTSTWPARCGTTRSVPRPGSACPP 601 RR +G TW A T R PR AC P Sbjct: 466 RRLAGRAGTWRASTATCRRTPRGTGACTP 380
>LOC_Os02g15020:12002.t01295:unspliced-genomic RING-H2 finger protein ATL5H precursor, putative| Length = 570 Score = 32.7 bits (65), Expect = 4.1 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +2 / -3 Query: 503 SLSTRRFSGCTSTWPARCGTTRSVPRPGSACPP 601 S + RR +G TW A T R PR AC P Sbjct: 481 SPAARRCTGRAGTWSASAATCRCSPRGTGACTP 383
>LOC_Os02g06330:12002.t00531:unspliced-genomic ethylene-responsive transcription factor 3, putative, expressed| Length = 1135 Score = 32.7 bits (65), Expect = 4.1 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -2 / +2 Query: 595 TRRTRSRHASCRSTPGRPCRCASTEPSRR 509 TRR R R S RSTP RP +T P R Sbjct: 89 TRRRRPRSGSARSTPQRPPPAPTTPPRGR 175
>LOC_Os02g04130:12002.t00312:unspliced-genomic expressed protein| Length = 1078 Score = 32.7 bits (65), Expect = 4.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 / -1 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRR 509 W RR C TPG P RC RR Sbjct: 400 WRRRRARGRGGCGRTPGTPARCGRARRCRR 311
>LOC_Os01g60930:12001.t05474:unspliced-genomic expressed protein| Length = 2925 Score = 32.7 bits (65), Expect = 4.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 / +3 Query: 509 STRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSR 619 S RR S C+ +W C + PG+ C P G+SR Sbjct: 1929 SWRRRSACSWSWRRACRSGSGTRAPGTRCCPS*GTSR 2039
>LOC_Os01g48750:12001.t04317:unspliced-genomic aspartic proteinase nepenthesin-2 precursor, putative, expressed| Length = 1180 Score = 32.7 bits (65), Expect = 4.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 / -1 Query: 592 RRTRSRHASCRSTPGRPCRCASTEPSRRQTV 500 R + SR CR+ P RPC C S+ TV Sbjct: 106 RWSPSRRPPCRAPPTRPCTCVPPSKSKYATV 14
>LOC_Os01g44240:12001.t03934:unspliced-genomic zinc finger, C3HC4 type family protein| Length = 456 Score = 32.7 bits (65), Expect = 4.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 / -3 Query: 592 RRTRSRHASCRSTPGR 545 RRTR RH CR++PGR Sbjct: 313 RRTRQRHRPCRTSPGR 266
>LOC_Os01g33360:12001.t02903:unspliced-genomic luminal-binding protein 2 precursor, putative, expressed| Length = 2047 Score = 32.7 bits (65), Expect = 4.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -2 / +3 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRRQTVSG 494 W RRTR+ AS R +P P + ST R+ +G Sbjct: 1665 WRRRTRAAPASRRGSPSSPVKATSTAA*ARRRSTG 1769
>LOC_Os01g04409:12001.t00328:unspliced-genomic OsWAK1 - OsWAK receptor-like cytoplasmic kinase (OsWAK-RLCK),| expressed Length = 9675 Score = 32.7 bits (65), Expect = 4.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 / -1 Query: 598 WTRRTRSRHASCRSTPGRPCRCAS 527 +T + SR +CR TPGR C C S Sbjct: 7005 YTCQGASRRGNCRRTPGRRCTCNS 6934
>LOC_Os06g06350:12006.t00521:unspliced-genomic ACS-like protein, putative, expressed| Length = 8079 Score = 29.0 bits (57), Expect(2) = 4.1 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 / -2 Query: 542 WPARCGTTRSVPRPGSACPPWSGSS 616 WPAR GT+ P S PP + SS Sbjct: 185 WPARSGTSARHSPPPSPTPPSASSS 111 Score = 26.7 bits (52), Expect(2) = 4.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 / -3 Query: 488 PCS*NSLSTRRFSGCTSTWPARC 556 PC LS R SGC T P C Sbjct: 448 PCRRRRLSGDRASGCPGTSPPNC 380
>LOC_Os02g51860:12002.t04767:unspliced-genomic ATP binding protein, putative, expressed| Length = 5768 Score = 31.8 bits (63), Expect(2) = 4.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 / +2 Query: 524 SGCTSTWPARCGTTRSVPRPGSA 592 +GC S+W C T+ S P GSA Sbjct: 665 AGCRSSWSRTCSTSASSPAAGSA 733 Score = 23.5 bits (45), Expect(2) = 4.2 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 / +2 Query: 20 ALRQCLVQQKLW 55 ALR CLV +LW Sbjct: 317 ALRLCLVSMRLW 352
>LOC_Os11g34250:12011.t02978:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1302 Score = 27.2 bits (53), Expect(2) = 4.2 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 / +2 Query: 503 SLSTRRFSGCTSTWPARCGTTRSVPRPGSA 592 S S+ R + TW ARC T RP S+ Sbjct: 1052 SASSPRLKALSPTWGARCRTKPGRSRPPSS 1141 Score = 22.6 bits (43), Expect(2) = 4.2 Identities = 9/32 (28%), Positives = 12/32 (37%) Frame = +2 / +2 Query: 692 SSSAPVNEWFLFAFGWRKDCGAIE*GRVSWRK 787 +S P N W + GW C R R+ Sbjct: 1163 NSPTPSNGWSAWDAGWASPCAGTRSSRPHSRR 1258
>LOC_Os05g31670:12005.t02764:unspliced-genomic ABA induced plasma membrane protein PM 19, putative, expressed| Length = 969 Score = 26.3 bits (51), Expect(2) = 4.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 / +3 Query: 562 RSTPGRPCRCASTEPSRRQTVSGT 491 RS+PG R S P+RR T + T Sbjct: 357 RSSPGPSPRSPSASPARRSTSAAT 428 Score = 23.5 bits (45), Expect(2) = 4.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -2 / +3 Query: 448 PCQPHQTSSAPSSFPPWAISRTSPPIT 368 PC +S A + P A + T+PP T Sbjct: 498 PCSTAASSPATTPPAPAATAATTPPTT 578
>LOC_Os04g35260:12004.t03197:unspliced-genomic ATP binding protein, putative, expressed| Length = 16921 Score = 25.4 bits (49), Expect(2) = 4.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 / +2 Query: 842 FIVFILCP*LACVVIF 889 FI ++LC *L C VIF Sbjct: 10319 FISYLLCT*L*CTVIF 10366 Score = 24.0 bits (46), Expect(2) = 4.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 / +2 Query: 808 TLPLSD*TGVSFHRFH 855 T+P S *T VSF FH Sbjct: 10166 TVPYSQ*TSVSFIMFH 10213
>LOC_Os10g26610:12010.t02072:unspliced-genomic mandelonitrile lyase, putative, expressed| Length = 5139 Score = 26.7 bits (52), Expect(2) = 5.0 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -2 / -1 Query: 451 *PCQPHQTSSAPSSFPPWAISRTSPP 374 *PC PH S+ S+ P +TS P Sbjct: 711 *PCWPHGASTRRSTMTPSLTKKTSNP 634 Score = 22.6 bits (43), Expect(2) = 5.0 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 / -1 Query: 577 RHASCRSTPGRPC 539 R A R+TPG PC Sbjct: 741 RSAQSRTTPG*PC 703
>LOC_Os02g53380:12002.t04917:unspliced-genomic expressed protein| Length = 3251 Score = 24.9 bits (48), Expect(2) = 5.2 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 / +2 Query: 423 DEVWCG*HGQYRRSTGRFHHSCPVPETVCRR 515 D+ WC * Q+ R F C E+ C++ Sbjct: 857 DQRWCP*SDQWHRRDREFIWRCHRSES*CKK 949 Score = 24.4 bits (47), Expect(2) = 5.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 / +2 Query: 551 RCGTTRSVPRPGSACPPWSGSSRT 622 RC + R PR CP +G +R+ Sbjct: 1070 RCASERRSPRQEPDCPKSAGCTRS 1141
>LOC_Os11g27240:12011.t02338:unspliced-genomic CRR4, putative, expressed| Length = 3070 Score = 27.2 bits (53), Expect(2) = 5.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 / -2 Query: 595 TRRTRSRHASCRSTPGR 545 T RTRS ASCR+ P R Sbjct: 2796 TTRTRST*ASCRTAPSR 2746 Score = 22.1 bits (42), Expect(2) = 5.2 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = -1 / -2 Query: 497 RNRAAVMEPPCRPPVLT 447 R R PPCR P T Sbjct: 2670 RPRTTAAHPPCRAPPRT 2620
>LOC_Os01g57610:12001.t05164:unspliced-genomic indole-3-acetic acid-amido synthetase GH3.1, putative, expressed| Length = 2942 Score = 26.3 bits (51), Expect(2) = 5.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -3 / -1 Query: 333 TWCEDSSNARPKCNNTGTG*C 271 TWC S C TG G*C Sbjct: 1238 TWCRSRSRRCTWCVATGAG*C 1176 Score = 23.1 bits (44), Expect(2) = 5.3 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -2 / -1 Query: 559 STPGRPCRCASTEPSRRQTVSGTGQL*WNRPVDRR 455 STP R C S RR+T + W R RR Sbjct: 1316 STPKRRTWCTSAAGRRRRTRASGCTATWCRSRSRR 1212
>LOC_Os10g40900:12010.t03330:unspliced-genomic flavonol synthase/flavanone 3-hydroxylase, putative| Length = 2812 Score = 25.4 bits (49), Expect(2) = 5.3 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -1 / -2 Query: 497 RNRAAVMEPPCRPP 456 R AA PPCRPP Sbjct: 1947 RRCAATGRPPCRPP 1906 Score = 24.0 bits (46), Expect(2) = 5.3 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 / -2 Query: 448 PCQPHQTSSAPSSFPPWAISRTSPPIT 368 PC+P T+ + SS P A TSP T Sbjct: 1920 PCRPPGTAGSRSS*CPAAGPGTSPAAT 1840
>LOC_Os08g24220:12008.t02192:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5477 Score = 31.3 bits (62), Expect(2) = 5.3 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 / -2 Query: 431 LVWLTWSIPAVDRAVPSQLPC 493 LV ++SIP+V R +PS LPC Sbjct: 1705 LVVASFSIPSVSRKLPSSLPC 1643 Score = 23.5 bits (45), Expect(2) = 5.3 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = +3 / -3 Query: 282 CLCCCTW 302 C CCC W Sbjct: 2445 CYCCCCW 2425
>LOC_Os05g26800:12005.t02335:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1296 Score = 26.7 bits (52), Expect(2) = 5.6 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 / +2 Query: 545 PARCGTTRSVPRPGSACPPWSGSSRTXXXXXRE*TSPLIS 664 PA + S PRP P W RT R TSP S Sbjct: 845 PATPSWSASSPRPKILSPTWGVWYRTRLGRSRPSTSPTTS 964 Score = 22.6 bits (43), Expect(2) = 5.6 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +2 / +2 Query: 692 SSSAPVNEWFLFAFGWRKDC 751 +S+ P N W + GW C Sbjct: 974 NSTMPSNGWSAWDAGWASPC 1033
>LOC_Os12g42190:12012.t03893:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 3695 Score = 32.2 bits (64), Expect = 5.6 Identities = 19/65 (29%), Positives = 25/65 (38%) Frame = -2 / +3 Query: 595 TRRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQL*WNRPVDRRY*PCQPHQTSSAP 416 T RS +S TP C+++ R +T W RP R C+P S Sbjct: 1491 TAAARSPSSSTARTPTAASHCSNSSRRRLRTTRRRRARTWRRPCRSR*WRCRPTSRSRRS 1670 Query: 415 SSFPP 401 SS P Sbjct: 1671 SSSTP 1685
>LOC_Os12g25120:12012.t02234:unspliced-genomic histone H2A.2, putative, expressed| Length = 1299 Score = 32.2 bits (64), Expect = 5.6 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +2 / +1 Query: 509 STRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 +TRR + C +T +RC TTRS P +A P + +S Sbjct: 541 TTRRPALCRATSSSRCATTRSSPSCSAAPPSPAAAS 648
>LOC_Os11g01820:12011.t00078:unspliced-genomic ATCHX15, putative, expressed| Length = 3023 Score = 32.2 bits (64), Expect = 5.6 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 / -2 Query: 500 NSLSTRRFSGCTSTWPARCGTTRSVPRPGSA 592 NS S + FS C++ P R + RSV P SA Sbjct: 1222 NSSSAQNFSSCSALTPIRLSSARSVR*PASA 1130
>LOC_Os10g32020:12010.t02522:unspliced-genomic expressed protein| Length = 3887 Score = 32.2 bits (64), Expect = 5.6 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 / +2 Query: 445 CQPHQTSSAPSSFPPWAISRTSP 377 C+P T++ PSS PP + + TSP Sbjct: 782 CRPRATATGPSSTPPTSTAATSP 850
>LOC_Os09g32230:12009.t02839:unspliced-genomic vignain precursor, putative, expressed| Length = 1495 Score = 32.2 bits (64), Expect = 5.6 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 / -2 Query: 527 GCTSTWPARCGTTRSVPRPGSACPPWSGSSR 619 G W +R G+ R PR GSA PP + SR Sbjct: 963 GRARCWASRSGSPRWRPRSGSASPPGTRRSR 871
>LOC_Os09g24820:12009.t02163:unspliced-genomic ZF-HD homeobox protein, putative, expressed| Length = 1985 Score = 32.2 bits (64), Expect = 5.6 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = -1 / -3 Query: 605 SRVDTPNPVAARFLSFHTGPAMSMCIH*TFSSTNCFRNRAAVMEPPCRPPVLTMSATPDF 426 SR + ++RF H + S CI S+ N RNR + PP P +A D Sbjct: 1200 SRHHSSTMASSRFWRRHPSRSESSCIRCFCSAVNLVRNRFLGIPPPPPPGGGAAAAAGDI 1021 Query: 425 IC 420 C Sbjct: 1020 TC 1015
>LOC_Os08g15420:12008.t01416:unspliced-genomic CSLC3 - cellulose synthase-like family C, expressed| Length = 4451 Score = 32.2 bits (64), Expect = 5.6 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 / -1 Query: 592 RRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQL*W 476 RR R R TP R CR + P+RR + +G G+ W Sbjct: 3662 RRRRPRRGRGCRTPTRSCRPSW*RPTRRSSPAGRGRRPW 3546
>LOC_Os06g36330:12006.t03330:unspliced-genomic antiporter/ drug transporter/ transporter, putative, expressed| Length = 1707 Score = 32.2 bits (64), Expect = 5.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 / -1 Query: 516 EGSVDAHRHGRPGVERQEACRDRVRR 593 EG+ + HR RP VE Q RDR R+ Sbjct: 330 EGAEEQHRQRRPRVEHQRRQRDRARQ 253
>LOC_Os06g36000:12006.t03297:unspliced-genomic transcriptional factor TINY, putative| Length = 1102 Score = 32.2 bits (64), Expect = 5.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 / +3 Query: 533 TSTWPARCGTTRSVPRPGSACPP 601 +S P RC T+R+ PRP A PP Sbjct: 597 SSRAPPRCSTSRAPPRPSRARPP 665
>LOC_Os06g18960:12006.t01719:unspliced-genomic cadmium tolerance factor, putative, expressed| Length = 4035 Score = 32.2 bits (64), Expect = 5.6 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 / +3 Query: 515 RRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSRT 622 RR +GC PA G+TR R PP + + RT Sbjct: 195 RRRAGCGRRTPAAAGSTRPATRRSRTSPPPAAARRT 302
>LOC_Os04g38070:12004.t03378:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6232 Score = 32.2 bits (64), Expect = 5.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 / +3 Query: 583 RSRHASCRSTPGRPCRCA 530 R+RHAS R P RPCR A Sbjct: 5754 RARHASGRRLPSRPCRAA 5807
>LOC_Os04g02680:12004.t00162:unspliced-genomic expressed protein| Length = 4330 Score = 32.2 bits (64), Expect = 5.6 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 / -2 Query: 583 RSRHASCRSTPGRPCRC 533 RSR S + PGRPCRC Sbjct: 174 RSRRRSAATPPGRPCRC 124
>LOC_Os03g22600:12003.t02010:unspliced-genomic transposon protein, putative, Mutator sub-class, expressed| Length = 2697 Score = 32.2 bits (64), Expect = 5.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 / -1 Query: 577 RHASCRSTPGRPCRCASTEP 518 R AS ++PGRPCRC++ P Sbjct: 1425 RAASRSASPGRPCRCSTPTP 1366
>LOC_Os03g10180:12003.t00820:unspliced-genomic expressed protein| Length = 5260 Score = 32.2 bits (64), Expect = 5.6 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -2 / -3 Query: 592 RRTRSRHASCRSTPGRPCRCASTEPSRR 509 RR RSR +C P PCR A P +R Sbjct: 278 RRRRSRRRTCSGAPPPPCRPALEAPPQR 195
>LOC_Os02g17350:12002.t01528:unspliced-genomic VHS and GAT domain protein, putative, expressed| Length = 5458 Score = 32.2 bits (64), Expect = 5.6 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 / -1 Query: 568 SCRSTPGRPCRCASTEPSRRQ 506 +CRS+ GRP R AS P RR+ Sbjct: 457 ACRSSRGRPARTASCSPPRRK 395
>LOC_Os02g14610:12002.t01256:unspliced-genomic hypothetical protein| Length = 755 Score = 32.2 bits (64), Expect = 5.6 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 / +2 Query: 495 PETVCRREGSVDAHRHGRPGVERQEACRDRVRR 593 PE +CR +G +A + G R + C RVRR Sbjct: 98 PENLCRLQGRREAELTRKEGTRRWQRCPRRVRR 196
>LOC_Os02g11640:12002.t00963:unspliced-genomic flavonol-3-O-glycoside-7-O-glucosyltransferase 1, putative, expressed| Length = 1808 Score = 32.2 bits (64), Expect = 5.6 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 / +3 Query: 571 ASCRSTPGRPCRCASTEPSRRQTVSGTGQ 485 ++CRS RPC C++T P R V+ G+ Sbjct: 1302 SACRSA*RRPCCCSATRPWRSPGVTSRGR 1388
>LOC_Os01g52660:12001.t04692:unspliced-genomic pistil-specific extensin-like protein precursor, putative,| expressed Length = 1166 Score = 32.2 bits (64), Expect = 5.6 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 / -3 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTGQ 485 R R A+ ++PG PCRCA + R+T G+ + Sbjct: 663 RRACRTATSATSPGTPCRCAG*SCAGRRTSPGSSR 559
>LOC_Os01g45010:12001.t03960:unspliced-genomic hypothetical protein| Length = 5344 Score = 32.2 bits (64), Expect = 5.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 / +3 Query: 536 STWPARCGTTRSVPRPGSACPPW 604 S WP+RC T RS R S PP+ Sbjct: 1029 SRWPSRCSTRRSSARGASRPPPF 1097
>LOC_Os01g36540:12001.t03202:unspliced-genomic selenium-binding protein-like, putative| Length = 1710 Score = 32.2 bits (64), Expect = 5.6 Identities = 19/60 (31%), Positives = 24/60 (40%) Frame = +2 / +2 Query: 476 PSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSRTXXXXXRE*TSP 655 P+ S +S S G TS P C T R PRP S P + + R +SP Sbjct: 128 PTTTSASASSSSAPTPRGATSPPPPACSTRRRRPRPSSTTPSSAPTPAASTSAPRSRSSP 307
>LOC_Os06g40580:12006.t03754:unspliced-genomic expressed protein| Length = 1165 Score = 24.9 bits (48), Expect(2) = 5.6 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 / +3 Query: 571 ASCRSTPGRPCRCASTEPSRRQTVSGTG 488 +SC PG P R AS R SG G Sbjct: 633 SSCWGAPGWPRRRASARRRRTPARSGAG 716 Score = 24.4 bits (47), Expect(2) = 5.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 / +3 Query: 380 SPDNSDAAVTSWASSSLGVKIP 315 SPD S AA W S + K+P Sbjct: 759 SPDPSAAAAARWTRSPVYDKVP 824
>LOC_Os01g57770:12001.t05179:unspliced-genomic polyneuridine-aldehyde esterase precursor, putative, expressed| Length = 5923 Score = 28.6 bits (56), Expect(2) = 5.7 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 / +3 Query: 503 SLSTRRFSGCTSTWPARCGTTRSVPRPGSA 592 S S + TS WP C TRS P SA Sbjct: 297 SSSATASAASTSRWPPSCSRTRSPPPCSSA 386 Score = 26.3 bits (51), Expect(2) = 5.7 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 / +3 Query: 878 VVIFCCVVQCEPALNCS 928 V CC + C PAL CS Sbjct: 5748 VAFCCCSLFCVPALRCS 5798
>LOC_Os01g27530:12001.t02456:unspliced-genomic expressed protein| Length = 920 Score = 25.4 bits (49), Expect(2) = 5.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 / -3 Query: 530 CTSTWPARCGTTRSVPRPGSACPPW 604 CT+T+PA ++R S PPW Sbjct: 666 CTATFPAIWPSSRPHSSRASRPPPW 592 Score = 24.0 bits (46), Expect(2) = 5.7 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / -3 Query: 374 RGRSSGDCPWRKATG 418 R RS G WR ATG Sbjct: 798 RRRSGGGAAWRPATG 754
>LOC_Os06g47910:12006.t04477:unspliced-genomic alpha-L-fucosidase 2 precursor, putative, expressed| Length = 2313 Score = 28.1 bits (55), Expect(2) = 6.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 / +3 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRRQT 503 W R S A+ S RP AS PSRR T Sbjct: 1422 WARTESSSRATSPSAACRPT*PASAHPSRRTT 1517 Score = 25.4 bits (49), Expect(2) = 6.1 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 / +1 Query: 135 SHSCATNHILTGSNNKVNLYSR 70 S++ + NHIL+ SNNK Y + Sbjct: 2053 SNA*SINHILSSSNNKNTNYKK 2118
>LOC_Os01g71950:12001.t06486:unspliced-genomic expressed protein| Length = 1766 Score = 30.9 bits (61), Expect(2) = 6.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 / -2 Query: 445 CQPHQTSSAPSSFPPWAISRTSPP 374 C P SSFPP + S TSPP Sbjct: 124 CSPASRCRCSSSFPPSSASATSPP 53 Score = 22.1 bits (42), Expect(2) = 6.5 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = -3 / -2 Query: 891 QNMTTHASHGHNMKTMK*NASLI*QGKCSMTCCFI 787 +++ HA+ HNM+ + AS + Q + + F+ Sbjct: 445 KSVVVHATQVHNMQDFEMVASALLQSQSTFRSVFL 341
>LOC_Os01g74550:12001.t06733:unspliced-genomic transposon protein, putative, unclassified| Length = 3561 Score = 30.4 bits (60), Expect(2) = 6.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 / +2 Query: 551 RCGTTRSVPRPGSACPPWSGSSR 619 RCG + +P CP WS +SR Sbjct: 3305 RCGASTPIPGGARPCPRWSRTSR 3373 Score = 23.5 bits (45), Expect(2) = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 / +2 Query: 374 RGRSSGDCPWRKATGSR*SLVWLTWS 451 +GRSS WR G + W +W+ Sbjct: 2657 KGRSSWPTRWRFCPGYTTATWWRSWA 2734
>LOC_Os01g09700:12001.t00847:unspliced-genomic 1-aminocyclopropane-1-carboxylate synthase 7, putative, expressed| Length = 3610 Score = 27.6 bits (54), Expect(2) = 6.7 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 / +3 Query: 448 PCQPHQTSSAPSSFPPWAISRTSPPIT 368 P P TSS+PSS P A +S P+T Sbjct: 2148 PAPPPPTSSSPSSSPTPATPCSSLPLT 2228 Score = 26.3 bits (51), Expect(2) = 6.7 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = -2 / +1 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRRQTVS 497 W RR R+ S GRP T PS T S Sbjct: 1684 WQRRRRTARTRRTSPGGRPTTRTPTTPSITPTAS 1785
>LOC_Os08g25130:12008.t02282:unspliced-genomic enhancer of polycomb-like protein, putative, expressed| Length = 11389 Score = 25.8 bits (50), Expect(3) = 6.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 / +1 Query: 871 GVCCHILLCRA 903 G CCHI LC A Sbjct: 10822 GFCCHIYLCSA 10854 Score = 25.4 bits (49), Expect(3) = 6.9 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 / +2 Query: 282 CLCCCTWA 305 C CCCTW+ Sbjct: 4355 C*CCCTWS 4378 Score = 24.9 bits (48), Expect(3) = 6.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 / +3 Query: 536 STWPARCGTTRSVPRPGSACPPW 604 S WP C T+ S+ GS C P+ Sbjct: 8163 SVWPGICCTS*SLLFLGSICKPF 8231
>LOC_Os10g32810:12010.t02589:unspliced-genomic beta-amylase, putative, expressed| Length = 2702 Score = 28.1 bits (55), Expect(2) = 7.0 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 / -3 Query: 453 YRRSTGRFHHSCPVPETVCRR 515 +RRS GR SC VP CRR Sbjct: 945 WRRSRGRCTRSCGVPIGRCRR 883 Score = 25.4 bits (49), Expect(2) = 7.0 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 / -1 Query: 566 RSVPRPGSACPPWSGSSRT 622 RS PGS PP SGS+R+ Sbjct: 572 RSSAPPGSPPPPSSGSARS 516
>LOC_Os09g38850:12009.t03352:unspliced-genomic OsWAK91 - OsWAK receptor-like protein kinase, expressed| Length = 3140 Score = 25.4 bits (49), Expect(2) = 7.0 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 / -2 Query: 586 TRSRHASCRSTPGRPCRCASTEPSRR 509 TRSR SCR R C C+ S R Sbjct: 1015 TRSRGGSCR*RCCRSCCCSGMRSSPR 938 Score = 23.5 bits (45), Expect(2) = 7.0 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -1 / -2 Query: 512 STNCFRNRAAVMEPPCRPPVLTMSATP 432 +T+C R R A P PP TP Sbjct: 928 TTSCGRRRTAR*RPAAPPPASATPPTP 848
>LOC_Os03g18910:12003.t01659:unspliced-genomic COBRA-like protein 7 precursor, putative, expressed| Length = 2579 Score = 26.3 bits (51), Expect(2) = 7.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -2 / +3 Query: 445 CQPHQTSSAPSSFPPWAISRTSP 377 C P + +AP S P W +SP Sbjct: 363 CSPTTSRAAPRSGPTWRTGTSSP 431 Score = 22.6 bits (43), Expect(2) = 7.1 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 / +3 Query: 598 WTRRTRSRHASCRSTPGR 545 W+R R R CR P R Sbjct: 264 WSRGWRRRRGRCRRRPPR 317
>LOC_Os03g47010:12003.t04063:unspliced-genomic hydrolase, hydrolyzing O-glycosyl compounds, putative, expressed| Length = 2787 Score = 30.9 bits (61), Expect(2) = 7.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 / -1 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSRRQT 503 R R CRS P PCR A T P+ T Sbjct: 663 RRRQVGPRCRSPPWPPCRSAGTSPAAAPT 577 Score = 22.6 bits (43), Expect(2) = 7.2 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 / -3 Query: 300 KCNNTGTG*CCQ 265 +C G+G*CC+ Sbjct: 178 RCRTPGSG*CCR 143
>LOC_Os05g05670:12005.t00457:unspliced-genomic 1-aminocyclopropane-1-carboxylate oxidase, putative, expressed| Length = 1928 Score = 25.8 bits (50), Expect(2) = 7.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 / -2 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTG 488 R R R ASC GR R PSRR + G Sbjct: 1183 RRR*RRASCAPCRGRGSRPWPPSPSRRAPAAPRG 1082 Score = 23.1 bits (44), Expect(2) = 7.3 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -1 / -2 Query: 515 SSTNCFRNRAAVMEPPCRPP 456 ++T C R PCRPP Sbjct: 1045 TATGCRRGGRRCPPSPCRPP 986
>LOC_Os12g30670:12012.t02774:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2032 Score = 28.6 bits (56), Expect(2) = 7.3 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 / -2 Query: 3 EV*HGRLCGSVWCSKSFGPNQASWSR 80 E+ G CG++ S S GP + SW R Sbjct: 1485 EITRGS*CGNITPSASSGPKEISWFR 1408 Score = 24.4 bits (47), Expect(2) = 7.3 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +3 / -3 Query: 432 WCG*HGQYRRSTGRFHHSCPVPETVCRREG 521 WC + RRS G F SC + C G Sbjct: 1151 WCAKSVRERRSRGLFGPSCGLAADGCSLAG 1062
>LOC_Os05g05680:12005.t00458:unspliced-genomic 1-aminocyclopropane-1-carboxylate oxidase, putative, expressed| Length = 1670 Score = 25.8 bits (50), Expect(2) = 7.4 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 / -3 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTG 488 R R R ASC GR R PSRR + G Sbjct: 861 RRR*RRASCAPCRGRGSRPWPPSPSRRAPAAPRG 760 Score = 23.1 bits (44), Expect(2) = 7.4 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -1 / -3 Query: 515 SSTNCFRNRAAVMEPPCRPP 456 ++T C R PCRPP Sbjct: 723 TATGCRRGGRRCPPSPCRPP 664
>LOC_Os01g50490:12001.t04483:unspliced-genomic flavonoid 3-monooxygenase, putative, expressed| Length = 2052 Score = 30.4 bits (60), Expect(2) = 7.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 / +2 Query: 524 SGCTSTWPARCGTTRSVPRPGSAC 595 S +WPARC TR+ P +C Sbjct: 224 SSIPPSWPARCSATRTPSSPTGSC 295 Score = 22.6 bits (43), Expect(2) = 7.4 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = +2 / +2 Query: 593 CPPWSGSSRTXXXXXRE*TSPLISIGSDNGVRDSSS 700 CP W ++R + TSP + S R S + Sbjct: 1232 CPSWCRTARAPPRRSADTTSPRAAACSSTSGRSSGT 1339
>LOC_Os08g02110:12008.t00108:unspliced-genomic peroxidase 47 precursor, putative, expressed| Length = 1425 Score = 24.9 bits (48), Expect(2) = 7.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 / -1 Query: 497 RNRAAVMEPPCRP 459 R+R A PPCRP Sbjct: 561 RSRTAAAAPPCRP 523 Score = 24.0 bits (46), Expect(2) = 7.5 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 / -1 Query: 448 PCQPHQTSSAPSSFPP 401 PC+P T+S PSS P Sbjct: 534 PCRPR*TASRPSSPSP 487
>LOC_Os05g40710:12005.t03610:unspliced-genomic DELLA protein GAI, putative| Length = 1482 Score = 27.2 bits (53), Expect(2) = 7.5 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 / -3 Query: 577 RHASCRSTPGRPCR 536 R A+C STP PCR Sbjct: 1435 RRAACPSTPAAPCR 1394 Score = 25.4 bits (49), Expect(2) = 7.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 / -3 Query: 427 SSAPSSFPPWAISRTSPPIT 368 S PSS PP + R++PP T Sbjct: 283 SPRPSSPPPRRLPRSTPPCT 224
>LOC_Os03g58780:12003.t05130:unspliced-genomic expressed protein| Length = 5864 Score = 29.9 bits (59), Expect(2) = 7.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 / -3 Query: 276 NRCLCCCTWA*HC 314 N C CCC W *+C Sbjct: 5094 NCCCCCCCWC*NC 5056 Score = 24.4 bits (47), Expect(2) = 7.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 / -1 Query: 557 GTTRSVPRPGSACPP 601 G T S PRP +A PP Sbjct: 206 GRTPSRPRPAAAAPP 162
>LOC_Os12g38170:12012.t03498:unspliced-genomic pathogenesis-related protein 5 precursor, putative, expressed| Length = 1136 Score = 31.8 bits (63), Expect = 7.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 515 RRFSGCTSTWPARCGTTRSVPRPGSACPPW 604 RR+ GC ST PA +T S GS C W Sbjct: 354 RRW*GCRSTAPAGWRSTASTSGKGSTCRRW 443
>LOC_Os12g18150:12012.t01665:unspliced-genomic jmjC domain containing protein, expressed| Length = 10217 Score = 31.8 bits (63), Expect = 7.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 / +1 Query: 377 GRSSGDCPWRKATGSR*SLVW 439 GR SG C WR A G R S W Sbjct: 718 GRRSGTCGWRPAPGGRCSAPW 780
>LOC_Os11g34660:12011.t03017:unspliced-genomic protease inhibitor/seed storage/LTP family protein, expressed| Length = 22839 Score = 31.8 bits (63), Expect = 7.7 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = -3 / +1 Query: 246 TLITSIDQSISKRKPPFSVSVIYLNRLPVRSSQNVTRSHSCATNHILTGSNNKVNLYSR 70 T I + S K P F V + + + + +N SH+ + NH+L+ +NN+ Y + Sbjct: 4915 TNINILPPSQKKTNPGFRVQCLTVLLI*KKYEKNKKISHA*SINHVLSSNNNENTNYKK 5091
>LOC_Os11g05690:12011.t00460:unspliced-genomic high-affinity cationic amino acid transporter 1, putative, expressed| Length = 5956 Score = 31.8 bits (63), Expect = 7.7 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 / +3 Query: 445 CQPHQTSSAPSSFPPWAISRTSPP 374 C +SSAPS+ PP + S +SPP Sbjct: 5460 CSSTSSSSAPSTAPPTSASASSPP 5531
>LOC_Os10g16850:12010.t01247:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3138 Score = 31.8 bits (63), Expect = 7.7 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 / +3 Query: 592 RRTRSRHASCRSTPGRPC 539 RR R+RHAS R P RPC Sbjct: 2670 RRGRARHASGRRLPSRPC 2723
>LOC_Os09g28770:12009.t02555:unspliced-genomic patatin class 1 precursor, putative, expressed| Length = 2846 Score = 31.8 bits (63), Expect = 7.7 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 / -3 Query: 471 RFHHSCPVPETVCRREGSVDAHRHGRPGVERQEACR 578 RFH TV S AH HG ER+ ACR Sbjct: 786 RFHEKQSRT*TVYNLNSSFRAHTHGYATTERESACR 679
>LOC_Os09g22090:12009.t01943:unspliced-genomic mannose-6-phosphate isomerase, putative, expressed| Length = 3691 Score = 31.8 bits (63), Expect = 7.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 / +3 Query: 598 WTRRTRSRHASCRSTPGRPCRCA 530 W RR+RSR R+ P R RCA Sbjct: 327 WPRRSRSRRTRTRNAPRRCTRCA 395
>LOC_Os08g34000:12008.t03140:unspliced-genomic transferase, transferring glycosyl groups, putative| Length = 612 Score = 31.8 bits (63), Expect = 7.7 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 / +2 Query: 476 PSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSAC 595 P+ S +++STR S T W AR G T PR + C Sbjct: 413 PTAACTSSSTVSTRHSSSRTRRWAARSGRTSGCPRAPTWC 532
>LOC_Os07g49250:12007.t04553:unspliced-genomic pyruvate decarboxylase isozyme 3, putative, expressed| Length = 2163 Score = 31.8 bits (63), Expect = 7.7 Identities = 18/58 (31%), Positives = 24/58 (41%) Frame = -2 / -1 Query: 547 RPCRCASTEPSRRQTVSGTGQL*WNRPVDRRY*PCQPHQTSSAPSSFPPWAISRTSPP 374 R RC+S R SG + P RR +P + P + P W RT+PP Sbjct: 264 RSARCSSPPRGARARRSGGPEASG*SPPARRTRRSRPPARGAEPGARPGWRRRRTAPP 91
>LOC_Os07g48280:12007.t04461:unspliced-genomic expressed protein| Length = 3476 Score = 31.8 bits (63), Expect = 7.7 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 / -1 Query: 551 RCGTTRSVPRPGSACPPWSGSSR 619 RC TT S R +A PPWS S R Sbjct: 2894 RC*TTSSSTRAAAARPPWSSSRR 2826
>LOC_Os07g38280:12007.t03494:unspliced-genomic insulin-degrading enzyme, putative, expressed| Length = 16085 Score = 31.8 bits (63), Expect = 7.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 / -2 Query: 545 PARCGTTRSVPRPGSACPPWSGSSR 619 PAR G T P G C PW+G++R Sbjct: 7549 PARHGPTAGGPCLGLRCSPWAGTTR 7475
>LOC_Os07g34060:12007.t03083:unspliced-genomic conserved hypothetical protein| Length = 1609 Score = 31.8 bits (63), Expect = 7.7 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 / -3 Query: 276 NRCLCCCTWA*HCWNL 323 N C CCC+W WN+ Sbjct: 878 NSCCCCCSWHIRSWNV 831
>LOC_Os06g42080:12006.t03899:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1834 Score = 31.8 bits (63), Expect = 7.7 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +2 / +3 Query: 449 SIPAVDRAVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSA 592 S A R++ + C+ STR T+ WP G S PRP +A Sbjct: 1542 STSARSRSLVATSGCAGFP*STRLIKSVTAAWPGSSGACPSRPRPSTA 1685
>LOC_Os06g18930:12006.t01716:unspliced-genomic conserved hypothetical protein| Length = 3622 Score = 31.8 bits (63), Expect = 7.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 / +3 Query: 524 SGCTSTWPARCGTTRSVPRPGSACPPWSGSS 616 + C+ T PA G + P + PPWS SS Sbjct: 2805 ASCSPTPPAAAGGSARPPTSSRSSPPWSASS 2897
>LOC_Os06g10760:12006.t00953:unspliced-genomic transmembrane emp24 domain-containing protein 10 precursor,| putative, expressed Length = 2645 Score = 31.8 bits (63), Expect = 7.7 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 / -2 Query: 542 WPARCGTTRSVPRPGSACPPWSGSSRT 622 W AR G TR+ R A P W+GS RT Sbjct: 298 WGARWGGTRT*GRSPRAPPRWAGSPRT 218
>LOC_Os06g03990:12006.t00290:unspliced-genomic aminotransferase ACS12, putative, expressed| Length = 3913 Score = 31.8 bits (63), Expect = 7.7 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -2 / -3 Query: 595 TRRTRSRHASCRSTPGRPCRCASTEPSRR 509 +R RSR +S S+P R CR AS + RR Sbjct: 242 SRTPRSRSSSSSSSPRRRCRSASWDADRR 156
>LOC_Os06g01870:12006.t00083:unspliced-genomic expressed protein| Length = 917 Score = 31.8 bits (63), Expect = 7.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 / +1 Query: 524 SGCTSTWPARCGTTRSVPRPGSACPP 601 SGC+S++P C +RS P PP Sbjct: 718 SGCSSSYPCCCSPSRSPPTSRGLAPP 795
>LOC_Os05g35594:12005.t03152:unspliced-genomic expressed protein| Length = 4030 Score = 31.8 bits (63), Expect = 7.7 Identities = 20/50 (40%), Positives = 22/50 (44%) Frame = +3 / +2 Query: 444 HGQYRRSTGRFHHSCPVPETVCRREGSVDAHRHGRPGVERQEACRDRVRR 593 HG R+ G VP RR V R GR GVE + A R R RR Sbjct: 2918 HGDAARAPGVPARDEDVPVLRRRRLRRVLRRRRGRQGVEEEPAARRRRRR 3067
>LOC_Os04g58230:12004.t05286:unspliced-genomic galactose-proton symporter, putative, expressed| Length = 1996 Score = 31.8 bits (63), Expect = 7.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 / +3 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRR 509 W R+R +SCR+ P R RC S P R Sbjct: 1104 W*SRSRRGGSSCRAGPPRRARCFSRSPMAR 1193
>LOC_Os04g35890:12004.t03259:unspliced-genomic protein kinase, putative, expressed| Length = 2846 Score = 31.8 bits (63), Expect = 7.7 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 / -3 Query: 595 TRRTRSRHASCRSTPGRPCRCASTEPSRR 509 TRR S ++ R+ PG PCR S+ RR Sbjct: 1119 TRRRTSTTSTARTDPGAPCRTPSSPRPRR 1033
>LOC_Os04g13170:12004.t01138:unspliced-genomic ribosomal RNA apurinic site specific lyase, putative, expressed| Length = 2077 Score = 31.8 bits (63), Expect = 7.7 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +2 / +3 Query: 455 PAVDRAVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPP 601 P R S PC +S T S +++ PA +TR R GS C P Sbjct: 429 PRARRPAQSPSPCPASSPRTPARSAASTSPPASWTSTRVCSRAGSRCSP 575
>LOC_Os04g12140:12004.t01038:unspliced-genomic expressed protein| Length = 9836 Score = 31.8 bits (63), Expect = 7.7 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +3 / -1 Query: 282 CLCCCTWA*HC 314 CL CCTW *HC Sbjct: 7535 CLLCCTWP*HC 7503
>LOC_Os03g61110:12003.t05344:unspliced-genomic RNA-binding motif protein, X-linked 2, putative, expressed| Length = 2310 Score = 31.8 bits (63), Expect = 7.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 / +3 Query: 516 EGSVDAHRHGRPGVERQEACRDRVRRVHP 602 EGS HR GR + + R R+RR HP Sbjct: 195 EGSASGHRRGRVVARQVQGLRLRLRRRHP 281
>LOC_Os03g59110:12003.t05161:unspliced-genomic pheophorbide a oxygenase, chloroplast precursor, putative,| expressed Length = 4406 Score = 31.8 bits (63), Expect = 7.7 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 / +2 Query: 589 RTRSRHASCRSTPGRPCRCASTEPSRRQTVSGT 491 R+RS SCR + R + + T PS + + SGT Sbjct: 698 RSRSTRRSCRGSGRRTSQTSMTRPSTQSSASGT 796
>LOC_Os03g53740:12003.t05707:unspliced-genomic expressed protein| Length = 1095 Score = 31.8 bits (63), Expect = 7.7 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 / +1 Query: 545 PARCGTTRSVPRPGSACPPWSGSS 616 PARCG +RS R G+ C P + SS Sbjct: 268 PARCGGSRSGRRRGTRCTP*TASS 339
>LOC_Os03g40000:12003.t03431:unspliced-genomic expressed protein| Length = 1915 Score = 31.8 bits (63), Expect = 7.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 / +1 Query: 524 SGCTSTWPARCGTTRSVPRPGSACPP 601 SGC+S++P C +RS P PP Sbjct: 847 SGCSSSYPCCCSPSRSPPTSRGLAPP 924
>LOC_Os03g36730:12003.t03141:unspliced-genomic oligosaccharide transporter, putative, expressed| Length = 6529 Score = 31.8 bits (63), Expect = 7.7 Identities = 22/73 (30%), Positives = 31/73 (42%) Frame = +2 / +3 Query: 488 PCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSRTXXXXXRE*TSPLISI 667 PCS +S R TST P+ ++ S P P S P +S + R ++ S Sbjct: 228 PCSSSSTPPRSTPRPTSTSPSSAASSPSSPPPSSPTTPPPPTSSSPTSSSRSRSTRSRSS 407 Query: 668 GSDNGVRDSSSAP 706 S +SSAP Sbjct: 408 ASTPSPTSASSAP 446
>LOC_Os03g15610:12003.t01347:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3183 Score = 31.8 bits (63), Expect = 7.7 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = -2 / +3 Query: 550 GRPCRCASTEPSRRQTVSGTGQL*WNRPVDRRY*PCQPHQTSSAPSSF 407 GR C + RR + G W R VDRR P H ++ PS+F Sbjct: 1680 GRGCTARARPLGRRLGRASFGGRPWVRHVDRRAEPRGAHTETALPSAF 1823
>LOC_Os03g01070:12003.t00007:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3135 Score = 31.8 bits (63), Expect = 7.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 / +3 Query: 589 RTRSRHASCRSTPGRPCRCA 530 R R++HAS R P RPCR A Sbjct: 2670 RGRAQHASGRRLPSRPCRAA 2729
>LOC_Os03g01060:12003.t00006:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6406 Score = 31.8 bits (63), Expect = 7.7 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 / +1 Query: 589 RTRSRHASCRSTPGRPCR 536 R R+RHAS R P RPCR Sbjct: 5941 RGRARHASGRRLPSRPCR 5994
>LOC_Os02g48670:12002.t04451:unspliced-genomic px19-like protein, putative, expressed| Length = 1115 Score = 31.8 bits (63), Expect = 7.7 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 / +1 Query: 509 STRRFSGCTSTWPARCGTTRSVPRPGSACPP 601 STRR GC P+RC RS ++ PP Sbjct: 346 STRRRGGCRLRAPSRCAPRRSPSSSAASSPP 438
>LOC_Os02g46460:12002.t04233:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 3610 Score = 31.8 bits (63), Expect = 7.7 Identities = 13/51 (25%), Positives = 22/51 (43%) Frame = +2 / +2 Query: 470 AVPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSRT 622 A P+ P + ++ S C+ WP+R S R G+ W+ + T Sbjct: 3011 AAPAGSPPTLTRATSTSSSSCSPCWPSRTSPCTSCARAGTGVARWTSTGAT 3163
>LOC_Os02g41630:12002.t03749:unspliced-genomic phenylalanine ammonia-lyase, putative, expressed| Length = 6620 Score = 31.8 bits (63), Expect = 7.7 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 / +2 Query: 550 GRPCRCASTEPSRRQTVSGT 491 GRPC CAST SR SG+ Sbjct: 1886 GRPCSCASTPSSRATPASGS 1945
>LOC_Os02g18750:12002.t01668:unspliced-genomic expressed protein| Length = 959 Score = 31.8 bits (63), Expect = 7.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 / +2 Query: 595 TRRTRSRHASCRSTPGRPCRCASTEPSRRQ 506 TR T R S TP PC +S +P+RR+ Sbjct: 305 TRPTPCRPTSAPWTPSSPCSASSLDPTRRR 394
>LOC_Os02g18620:12002.t01655:unspliced-genomic hypothetical protein| Length = 975 Score = 31.8 bits (63), Expect = 7.7 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +3 / -3 Query: 480 HSCPVPETVCRREGSVDAHRHGRPGVERQEACRDRVRRVH 599 H CP P R + ++D H+ P +CR R RR H Sbjct: 778 HQCPSPRQPSRGDRTLDEHQCRPPTPNCPLSCRRRHRRRH 659
>LOC_Os01g51500:12001.t04582:unspliced-genomic hypothetical protein| Length = 633 Score = 31.8 bits (63), Expect = 7.7 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +2 / -3 Query: 473 VPSQLPCS*NSLSTRRFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSR 619 +P+ PC+ ++ ++R TS P + R+ P P P W+ S R Sbjct: 550 LPASSPCTTSTSASRSRGRTTSRRPRAPRSRRAAPPPCDRVPHWAASRR 404
>LOC_Os01g42090:12001.t03729:unspliced-genomic seven-transmembrane-domain protein 1, putative, expressed| Length = 2633 Score = 31.8 bits (63), Expect = 7.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 / -3 Query: 509 STRRFSGCTSTWPARCGTTRSVPRPGS 589 S RR GC +W A C RS RP S Sbjct: 726 SRRRRRGCRRSWNASCACARSEARPES 646
>LOC_Os01g37560:12001.t03298:unspliced-genomic chaperone protein dnaJ 49, putative, expressed| Length = 4775 Score = 31.8 bits (63), Expect = 7.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 / -1 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSR 512 W R R CR P RP RC T P R Sbjct: 569 WPWRGT*RRGRCRRRPPRPSRCGGT*PRR 483
>LOC_Os01g22370:12001.t01972:unspliced-genomic peroxidase 1 precursor, putative, expressed| Length = 4113 Score = 31.8 bits (63), Expect = 7.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 / +1 Query: 515 RRFSGCTSTWPARCGTTRSVPRPGSAC 595 RR + C+ WP R TT + P SAC Sbjct: 151 RRSAWCSRRWPPRSRTTAASPPASSAC 231
>LOC_Os01g10460:12001.t00920:unspliced-genomic expressed protein| Length = 3113 Score = 31.8 bits (63), Expect = 7.7 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 / -2 Query: 595 TRRTRSRHASCRSTPGRPCRCASTEPSRRQ 506 T TRSR SCR TP R R + + P+ R+ Sbjct: 448 TLPTRSRPRSCRRTPRRSSRWSRSSPAPRR 359
>LOC_Os10g01134:12010.t00013:unspliced-genomic serine carboxypeptidase 1 precursor, putative, expressed| Length = 6317 Score = 27.6 bits (54), Expect(2) = 8.0 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 / +2 Query: 533 TSTWPARCGTTRSVPRPGSACPPWS 607 T T P RC + P P + C WS Sbjct: 5489 TPTAPTRCRPSAWQPSPSTRCTSWS 5563 Score = 26.7 bits (52), Expect(2) = 8.0 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 / +2 Query: 267 GNTNRCLCCCTW 302 G RC CCC W Sbjct: 56 GPHRRCCCCCCW 91
>LOC_Os05g41300:12005.t03668:unspliced-genomic hypothetical protein| Length = 2372 Score = 26.7 bits (52), Expect(2) = 8.4 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 / +2 Query: 521 FSGCTSTWPARCGTTRSVPRPGSACPPW 604 +S C+S G S P P S PPW Sbjct: 965 YSACSSAATTASGRGSSWPPPWSP*PPW 1048 Score = 26.3 bits (51), Expect(2) = 8.4 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +3 / +1 Query: 270 NTNRCLCCCTW 302 +T C CCC+W Sbjct: 637 STGLCCCCCSW 669
>LOC_Os05g49210:12005.t04354:unspliced-genomic OsWRKY43 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 2480 Score = 30.4 bits (60), Expect(2) = 8.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 / +3 Query: 592 RRTRSRHASCRSTPGRPCRCASTEPSR 512 RR RS +SCR P RC + P+R Sbjct: 1344 RRRRSSSSSCRRAGFPPTRCPGSSPAR 1424 Score = 22.6 bits (43), Expect(2) = 8.7 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -1 / +1 Query: 497 RNRAAVMEPPCRPP 456 R+R PPC PP Sbjct: 2299 RSRRTQTSPPCSPP 2340
>LOC_Os12g28270:12012.t02537:unspliced-genomic amidohydrolase family protein, putative, expressed| Length = 6350 Score = 25.4 bits (49), Expect(2) = 8.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / +3 Query: 563 TRSVPRPGSACPPW 604 T P PG+A PPW Sbjct: 270 TAPSPSPGTASPPW 311 Score = 23.1 bits (44), Expect(2) = 8.9 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +2 / +3 Query: 524 SGCTSTWPARCGTTRSVPRP 583 +G +S W A ++R+ P P Sbjct: 225 AGSSSAWTAASASSRTAPSP 284
>LOC_Os01g72690:12001.t06556:unspliced-genomic NAD kinase 1, putative, expressed| Length = 5896 Score = 25.4 bits (49), Expect(2) = 8.9 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 / -1 Query: 689 DSSSAPVNEWFLFAFGWR 742 D S P N+W F WR Sbjct: 5470 DQSRGPSNDWDFLRFQWR 5417 Score = 23.1 bits (44), Expect(2) = 8.9 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 / -2 Query: 856 IVPVTGVCCHILLCRA 903 ++P G CC++ L RA Sbjct: 5289 MMPKLGPCCYVALVRA 5242
>LOC_Os04g55800:12004.t05052:unspliced-genomic sulfate transporter 3.3, putative, expressed| Length = 5617 Score = 25.8 bits (50), Expect(2) = 9.0 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 / +2 Query: 518 RFSGCTSTWPARCGTTRSVPRPGSACPPWSGSSRT 622 R S C + RC + + P ++ P W SS T Sbjct: 1343 RRSSCRCSSSRRCSASSTSPPRWASSPSWPPSSTT 1447 Score = 22.6 bits (43), Expect(2) = 9.0 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +3 / +3 Query: 477 HHSCPVPETVCRREGSVDAHR 539 HH PV CR G HR Sbjct: 1293 HHRFPVEGDACRVHGRRGDHR 1355
>LOC_Os08g09110:12008.t00797:unspliced-genomic NB-ARC domain containing protein, expressed| Length = 4652 Score = 25.8 bits (50), Expect(2) = 9.1 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 / -2 Query: 421 APSSFPPWAISRTSPPIT 368 APSS PP A S +PP T Sbjct: 94 APSSRPPSAASAPAPPST 41 Score = 22.6 bits (43), Expect(2) = 9.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -2 / -2 Query: 598 WTRRTRSRHASCRSTPGR 545 W RR RSR A R GR Sbjct: 181 WRRRRRSRGACGRRRGGR 128
>LOC_Os06g09230:12006.t00802:unspliced-genomic serine threonine kinase, putative, expressed| Length = 4511 Score = 24.9 bits (48), Expect(2) = 9.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 / -3 Query: 424 SAPSSFPPWAISRTSPPIT 368 ++PS+ P SRTSPP T Sbjct: 3111 ASPSAGTPGRCSRTSPPST 3055 Score = 23.5 bits (45), Expect(2) = 9.1 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -2 / -3 Query: 592 RRTRSRHASCRSTPGRPCRCASTEPSR 512 R T + R PGR CR A P R Sbjct: 3285 RGTAPPRRASRGRPGRACRRARRAPWR 3205
>LOC_Os08g37370:12008.t03474:unspliced-genomic mitochondrial 2-oxoglutarate/malate carrier protein, putative,| expressed Length = 1484 Score = 24.9 bits (48), Expect(3) = 9.2 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -1 / +2 Query: 506 NCFRNRAAVMEPPCRPPVLTMSATP 432 +C R P CRPP +TP Sbjct: 515 SCGRRARRGSSPACRPPCCARRSTP 589 Score = 23.5 bits (45), Expect(3) = 9.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 / +2 Query: 427 SSAPSSFPPWAISRTSP 377 SS S PPW TSP Sbjct: 683 SSPAGSAPPWGTRPTSP 733 Score = 21.7 bits (41), Expect(3) = 9.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 / +2 Query: 592 RRTRSRHASCRSTPGRPCRCASTEPSRR 509 RR R RST GRP R T RR Sbjct: 398 RRRRRCGRRWRSTRGRPWRSRMT*LRRR 481
>LOC_Os07g38790:12007.t03543:unspliced-genomic beta-hexosaminidase precursor, putative, expressed| Length = 2482 Score = 26.3 bits (51), Expect(2) = 9.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 / +2 Query: 542 WPARCGTTRSVPRPGSACP 598 W RCG + P GSA P Sbjct: 1949 WRRRCGRATATPPAGSATP 2005 Score = 22.1 bits (42), Expect(2) = 9.6 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 / +2 Query: 512 TRRFSGCTST 541 TRR SGCT+T Sbjct: 1796 TRRGSGCTTT 1825
>LOC_Os04g41750:12004.t03731:unspliced-genomic expressed protein| Length = 1869 Score = 26.3 bits (51), Expect(2) = 9.8 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 / -2 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPS 515 WT RTR R R+ G R T P+ Sbjct: 1277 WTPRTRRRRPRRRTPAGTTARARCTPPA 1194 Score = 22.1 bits (42), Expect(2) = 9.8 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 / -2 Query: 473 PPCRPP 456 PPCRPP Sbjct: 1184 PPCRPP 1167
>LOC_Os09g17740:12009.t01559:unspliced-genomic chlorophyll a-b binding protein 1, chloroplast precursor, putative,| expressed Length = 1467 Score = 29.0 bits (57), Expect(2) = 10.0 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -2 / +1 Query: 448 PCQPHQTSSAPSSFPPWAISRTSP 377 PC P SS+ S P A SRTSP Sbjct: 805 PCSPCSASSSRPSSPARAPSRTSP 876 Score = 23.1 bits (44), Expect(2) = 10.0 Identities = 11/37 (29%), Positives = 13/37 (35%) Frame = -2 / +1 Query: 598 WTRRTRSRHASCRSTPGRPCRCASTEPSRRQTVSGTG 488 W R R + G PC PSRR+ G Sbjct: 184 WPARRRRPPPRSSARRGSPCARPPRSPSRRRRRGARG 294
>LOC_Os02g34240:12002.t03063:unspliced-genomic hypothetical protein| Length = 1530 Score = 24.9 bits (48), Expect(2) = 10.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 / -2 Query: 560 TTRSVPRPGSACPPWSGSS 616 +TR +PR G PP S SS Sbjct: 149 STRMLPRNGGRAPPPSASS 93 Score = 23.5 bits (45), Expect(2) = 10.0 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 / -3 Query: 534 HRHGRPGVERQEAC 575 HRH RPG AC Sbjct: 178 HRHHRPGPATPRAC 137
>LOC_Os07g35270:12007.t03202:unspliced-genomic hypothetical protein| Length = 1056 Score = 28.1 bits (55), Expect(2) = 10.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 / +3 Query: 515 RRFSGCTSTWPARCGT 562 R CT +WP +CGT Sbjct: 570 RMMCACTRSWPRQCGT 617 Score = 23.5 bits (45), Expect(2) = 10.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 / +3 Query: 716 WFLFAFGWRKDCG 754 W+ FGWR CG Sbjct: 816 WWSSFFGWRGACG 854 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 428,669,128 Number of extensions: 7696526 Number of successful extensions: 50927 Number of sequences better than 10.0: 248 Length of query: 317 Length of database: 55,613,886 Length adjustment: 50 Effective length of query: 267 Effective length of database: 52,799,986 Effective search space: 14097596262 Effective search space used: 14097596262 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
