| Clone Name | FLbaf154d11 |
|---|---|
| Clone Library Name | barley_pub |
>P08313:UL47_HHV1F Virion protein UL47 - Human herpesvirus 1 (strain F) (HHV-1) (Human| herpes simplex virus 1) Length = 664 Score = 31.6 bits (70), Expect = 3.0 Identities = 20/57 (35%), Positives = 25/57 (43%) Frame = +2 Query: 104 RLVSPGEDRHGTGRREEAQLIAAGEPPIRHERRTGQCSSWRLLHRPSGKHRRAQRER 274 R V G+D EE +A EPP+R R + R P HRRA R+R Sbjct: 38 RAVFRGDDDSELEALEE---MAGDEPPVRRRREGPRARRRRASEAPPTSHRRASRQR 91
>P10231:UL47_HHV11 Virion protein UL47 - Human herpesvirus 1 (strain 17) (HHV-1)| (Human herpes simplex virus 1) Length = 693 Score = 31.6 bits (70), Expect = 3.0 Identities = 20/57 (35%), Positives = 25/57 (43%) Frame = +2 Query: 104 RLVSPGEDRHGTGRREEAQLIAAGEPPIRHERRTGQCSSWRLLHRPSGKHRRAQRER 274 R V G+D EE +A EPP+R R + R P HRRA R+R Sbjct: 38 RAVFRGDDDSELEALEE---MAGDEPPVRRRREGPRARRRRASEAPPTSHRRASRQR 91
>Q9ESJ1:CABL1_MOUSE CDK5 and ABL1 enzyme substrate 1 - Mus musculus (Mouse)| Length = 568 Score = 31.2 bits (69), Expect = 3.9 Identities = 24/62 (38%), Positives = 31/62 (50%), Gaps = 7/62 (11%) Frame = -3 Query: 336 RSNHQEDCSQPEQAQGGPAAVLSLW--ARRCLPDGR*SSLQ-----EEHCPVRRSWRMGG 178 R N Q C+ + QGG + L ARR L R SSL+ EE+ P+RR + G Sbjct: 215 RQNSQNYCALEQSGQGGSTSALEQLQRARRRLISQR-SSLETLEDIEENAPLRRCRTLSG 273 Query: 177 SP 172 SP Sbjct: 274 SP 275
>Q96T25:ZIC5_HUMAN Zinc finger protein ZIC 5 - Homo sapiens (Human)| Length = 639 Score = 25.8 bits (55), Expect(2) = 4.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 372 PPPPKPSFLAKFCPCLAGGGATS 440 PPPP P L+ + +GGG +S Sbjct: 143 PPPPPPPALSGYTTTNSGGGGSS 165 Score = 23.9 bits (50), Expect(2) = 4.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 324 GDYFVGRPSNHEQNTTPPPPKP 389 G Y G S+ Q + PPPP P Sbjct: 110 GSYPCGGGSSGAQPSAPPPPAP 131
>Q3JSI8:RBSA1_BURP1 Ribose import ATP-binding protein rbsA 1 - Burkholderia| pseudomallei (strain 1710b) Length = 859 Score = 30.8 bits (68), Expect = 5.1 Identities = 20/65 (30%), Positives = 25/65 (38%) Frame = +2 Query: 86 ARRAGRRLVSPGEDRHGTGRREEAQLIAAGEPPIRHERRTGQCSSWRLLHRPSGKHRRAQ 265 ARR RR EDRH + E P+ + G R+ R +HRRA Sbjct: 38 ARRGERRARGTAEDRHD---------VPGAEQPVLRDDAKGARRGGRVDRRAGDRHRRAS 88 Query: 266 RERTA 280 R A Sbjct: 89 RREQA 93
>Q9UMF0:ICAM5_HUMAN Intercellular adhesion molecule 5 precursor - Homo sapiens (Human)| Length = 924 Score = 30.4 bits (67), Expect = 6.7 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 225 LQEEHCPVRRSWRMGGSPAAISCASSLRPVP 133 + E CP ++W G +A++CA+ RP P Sbjct: 668 MDESTCPSHQTWLEGAEASALACAARGRPSP 698
>P28829:BYR2_SCHPO Protein kinase byr2 - Schizosaccharomyces pombe (Fission yeast)| Length = 659 Score = 30.0 bits (66), Expect = 8.7 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = -3 Query: 222 QEEHCP----VRRSWRMG-GSPAAISCASSLRPVPCLSSPGETRRRPAR 91 +E+ CP +RRSW + PAA+S SSL P P T++R R Sbjct: 148 KEKPCPSFEDLRRSWEIELAQPAALSSQSSLSPKLSSVLPTSTQKRSVR 196 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 123,060,314 Number of extensions: 2871662 Number of successful extensions: 8126 Number of sequences better than 10.0: 7 Number of HSP's gapped: 8103 Number of HSP's successfully gapped: 8 Length of query: 232 Length of database: 100,686,439 Length adjustment: 110 Effective length of query: 122 Effective length of database: 70,513,989 Effective search space: 8602706658 Effective search space used: 8602706658 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)