| Clone Name | FLbaf151a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | A3EXH0:NCAP_BCHK9 Nucleocapsid protein - Bat coronavirus HKU9 (B... | 33 | 2.7 | 2 | P25601:YCH5_YEAST Putative transposon Ty5-1 protein YCL075W - Sa... | 33 | 3.5 | 3 | Q9HGI2:RAD52_NEUCR DNA repair and recombination protein mus-11 -... | 32 | 7.9 |
|---|
>A3EXH0:NCAP_BCHK9 Nucleocapsid protein - Bat coronavirus HKU9 (BtCoV) (BtCoV/HKU9)| Length = 468 Score = 33.1 bits (74), Expect = 2.7 Identities = 21/63 (33%), Positives = 31/63 (49%) Frame = +1 Query: 655 LGGRHRSYTARDGEP*PPIRFNARSTGPLRSLGRRSGAHAGRRPRLCHHKHGGSPQRAVR 834 + GR+RS R G P P + F S G RR+G G RP+ ++ GS + + Sbjct: 1 MSGRNRS---RSGTPSPKVTFKQESDGSDSESERRNGNRNGARPK--NNNSRGSAPKPEK 55 Query: 835 PRA 843 P+A Sbjct: 56 PKA 58
>P25601:YCH5_YEAST Putative transposon Ty5-1 protein YCL075W - Saccharomyces| cerevisiae (Baker's yeast) Length = 146 Score = 32.7 bits (73), Expect = 3.5 Identities = 20/56 (35%), Positives = 27/56 (48%) Frame = +2 Query: 695 NRDLLSGLTPDQPGRFVLSADGAAPMQVVAHGCVITNTVVLPNVLYVPGLTANLVS 862 +R + S T FV G+ P ++ G V TV L +V YVP L NL+S Sbjct: 92 DRSIFSSFTRSSRKDFVRGVGGSIP--IMGSGTVNIGTVQLHDVSYVPDLPVNLIS 145
>Q9HGI2:RAD52_NEUCR DNA repair and recombination protein mus-11 - Neurospora crassa| Length = 600 Score = 31.6 bits (70), Expect = 7.9 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 682 ARDGEP*PPIRFNARSTGPLRSLGRRSGAHAGRRP 786 AR+G+ PP + P SL R +GAHA RP Sbjct: 418 ARNGQHVPPAKTTETEAEPSTSLSRPAGAHAASRP 452 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 250,407,893 Number of extensions: 5806986 Number of successful extensions: 14532 Number of sequences better than 10.0: 3 Number of HSP's gapped: 14526 Number of HSP's successfully gapped: 3 Length of query: 444 Length of database: 100,686,439 Length adjustment: 116 Effective length of query: 328 Effective length of database: 68,868,219 Effective search space: 22588775832 Effective search space used: 22588775832 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)