ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf144p13 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os02g54770:12002.t05055:unspliced-genomic splicing factor, arginine/serine-rich 7, putative, expressed| Length = 4678 Score = 79.4 bits (167), Expect(6) = 8e-53 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 / +3 Query: 325 GICSPWPACMLATWMPG*LLGNLKMSFVCLEFCE 426 GICS WPACMLATW+P *L GNLKMSFVCLEFCE Sbjct: 1074 GICSRWPACMLATWIPE*LPGNLKMSFVCLEFCE 1175 Score = 79.4 bits (167), Expect(6) = 8e-53 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 / +3 Query: 426 SVWVARKPPGFAFIDFDDKRDAEDALRDLDG 518 SVWVARKPPGFAFIDFDDKRDAEDALRDLDG Sbjct: 1656 SVWVARKPPGFAFIDFDDKRDAEDALRDLDG 1748 Score = 67.0 bits (140), Expect(6) = 8e-53 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFARECRLRIGAGGL 701 S+MKCYECGE+GHFARECRLRIG GGL Sbjct: 3033 SEMKCYECGETGHFARECRLRIGPGGL 3113 Score = 35.0 bits (70), Expect(6) = 8e-53 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 / +2 Query: 776 QKKLQPS*SLSKTPQCFSS 832 ++KLQ S*SLSK PQCF+S Sbjct: 3458 EQKLQSS*SLSKAPQCFTS 3514 Score = 34.1 bits (68), Expect(6) = 8e-53 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 / +3 Query: 510 LDGKNGWRVELSRN 551 L GKNGWRVELSRN Sbjct: 2955 LIGKNGWRVELSRN 2996 Score = 24.0 bits (46), Expect(6) = 8e-53 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 / +2 Query: 1065 SVIKKIMWWMWYAKK 1109 S +KK+M WM YA K Sbjct: 3845 SDVKKLMGWM*YATK 3889 Score = 76.2 bits (160), Expect(5) = 5e-41 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -3 / -1 Query: 425 SQNSKHTKLIFKFPSSHPGIQVANIQAGHGEQIP 324 SQNSKHTKLIFKFP SH GIQVANIQAGH EQIP Sbjct: 1174 SQNSKHTKLIFKFPGSHSGIQVANIQAGHREQIP 1073 Score = 60.6 bits (126), Expect(5) = 5e-41 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -2 / -2 Query: 714 AFHCPDPQHQYADDIHEQSAQIHHIHSISYQT 619 AFH PD Q QYA+DIHEQSAQ HH HS S QT Sbjct: 3126 AFHYPDLQDQYANDIHEQSAQFHHTHSTSSQT 3031 Score = 56.5 bits (117), Expect(5) = 5e-41 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 / -3 Query: 515 I*ITKCIFSIPLVIKINKRKTRWFTCNPYTS 423 I*IT+CI SIPLVIKI+K KTRWFT NP T+ Sbjct: 1745 I*ITECILSIPLVIKIDKCKTRWFTGNPDTA 1653 Score = 38.6 bits (78), Expect(5) = 5e-41 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -2 / -2 Query: 849 CDHGLGLEKHCGVLESDHEGCNF 781 C L KHCG LESDHE C+F Sbjct: 3531 CSCAHELVKHCGALESDHEDCSF 3463 Score = 26.7 bits (52), Expect(5) = 5e-41 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 / -1 Query: 1103 CIPHPPHNFFNDR 1065 CI HP H FFN R Sbjct: 3883 CILHPSHKFFNVR 3845 Score = 77.1 bits (162), Expect(4) = 2e-35 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 / +2 Query: 324 RDLFTMARLYVGNLDARVTAGELEDEFRVFGVLR 425 RDLFTMARLYVGNLD RVT+GELEDEFRVFGVLR Sbjct: 1073 RDLFTMARLYVGNLDPRVTSGELEDEFRVFGVLR 1174 Score = 59.7 bits (124), Expect(4) = 2e-35 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +2 / +2 Query: 410 VWSFAKCMGCT*TTWFCVY*F**QAGC*RCTS*SRW 517 V+ +C+GC *TTWFC+Y F**Q GC* CT * RW Sbjct: 1640 VYFSMQCLGCP*TTWFCIYRF**QEGC*GCTP*FRW 1747 Score = 57.4 bits (119), Expect(4) = 2e-35 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +2 / +2 Query: 620 V*YEML*MW*IWALCS*MSSAYWCWGSGQWKA 715 V* E+L*+W* WALCS*MS AYW W SG WKA Sbjct: 3032 V*DEVL*VW*NWALCS*MSFAYWSWRSG*WKA 3127 Score = 24.9 bits (48), Expect(4) = 2e-35 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 / +1 Query: 781 EVTALVIALQDAAVLLQ 831 E T LVIALQ AAV Q Sbjct: 3463 EATVLVIALQGAAVFHQ 3513 Score = 70.3 bits (147), Expect(6) = 7e-28 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 / -3 Query: 426 FAKLQTHETHLQVPQQSPGHPSCQHTSGPW*TDPESSR 313 FA+LQTHETHLQVP++S G PSCQHTSGP *T+P S + Sbjct: 1175 FAELQTHETHLQVPRKSLGDPSCQHTSGPS*TNP*SKK 1062 Score = 40.0 bits (81), Expect(6) = 7e-28 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 / -1 Query: 673 HSRAKCPDSPHS*HFI 626 HSRAKCP SPHS*HFI Sbjct: 3085 HSRAKCPVSPHS*HFI 3038 Score = 33.1 bits (66), Expect(6) = 7e-28 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 / -2 Query: 516 HLDHEVHLQHPACH 475 HL+H VH QHP+CH Sbjct: 1746 HLNHGVHPQHPSCH 1705 Score = 32.7 bits (65), Expect(6) = 7e-28 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 / -1 Query: 466 INAKPGGLRATHTL 425 INAKPGGLRAT TL Sbjct: 1696 INAKPGGLRATQTL 1655 Score = 31.3 bits (62), Expect(6) = 7e-28 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 / -3 Query: 830 WRSTAASWRAITRAVTS 780 W +TAA WRAITR V S Sbjct: 3512 W*NTAAPWRAITRTVAS 3462 Score = 24.9 bits (48), Expect(6) = 7e-28 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 / -1 Query: 865 GDLL*LRPRAG 833 GDLL*LRPR G Sbjct: 3541 GDLL*LRPRTG 3509 Score = 72.1 bits (151), Expect = 7e-12 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = +2 / +1 Query: 317 LLSGSVHHGPLVCWQLGCPGDCWGT*R*VSCVWSFAKCMGC 439 LL G VH GPLVCWQLG P D GT*R*VSCVWS AK C Sbjct: 1066 LLQGFVHDGPLVCWQLGSPSDFRGT*R*VSCVWSSAKVSFC 1188 Score = 51.9 bits (107), Expect = 8e-06 Identities = 27/42 (64%), Positives = 29/42 (69%) Frame = +1 / +1 Query: 391 LKMSFVCLEFCEVYGLHVNHLVLRLLILMTSGMLKMHFVI*M 516 L M F + F V GL VNHLVL L ILMT GML+MH VI*M Sbjct: 1621 LLM*FSSVFFHAVSGLPVNHLVLHLSILMTRGMLRMHSVI*M 1746 Score = 32.7 bits (65), Expect(2) = 0.043 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 / -3 Query: 665 SKVPRFTTFIAFHIRP 618 SKVP FTT IA H+RP Sbjct: 3077 SKVPSFTTLIALHLRP 3030 Score = 29.9 bits (59), Expect(2) = 0.043 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 / -2 Query: 364 KLPTYKRAMVNRS 326 KLPTYKRA+VN+S Sbjct: 1113 KLPTYKRAIVNKS 1075
>LOC_Os02g39720:12002.t03609:unspliced-genomic splicing factor, arginine/serine-rich 7, putative, expressed| Length = 4250 Score = 78.0 bits (164), Expect(4) = 1e-40 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 / +3 Query: 417 VLRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG 518 +L SVWVARKPPGFAFIDFDD+RDAEDA+RDLDG Sbjct: 1512 LLCSVWVARKPPGFAFIDFDDRRDAEDAIRDLDG 1613 Score = 68.9 bits (144), Expect(4) = 1e-40 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFARECRLRIGAGGL 701 SDMKCYECGE GHFARECRLRIG+GGL Sbjct: 2571 SDMKCYECGEPGHFARECRLRIGSGGL 2651 Score = 60.6 bits (126), Expect(4) = 1e-40 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 / +2 Query: 339 MARLYVGNLDARVTAGELEDEFRVFGVLR 425 MAR+YVGNLD RVTA E+EDEFRVFGVLR Sbjct: 368 MARVYVGNLDPRVTAREIEDEFRVFGVLR 454 Score = 29.0 bits (57), Expect(4) = 1e-40 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 / +3 Query: 510 LDGKNGWRVELS 545 L GKNGWRVELS Sbjct: 2493 LIGKNGWRVELS 2528 Score = 58.8 bits (122), Expect(5) = 6e-19 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -3 / -1 Query: 527 SILAI*ITKCIFSIPLVIKINKRKTRWFTCNPYTS 423 +++ I*IT CIF IP VIK+NK KT WF+ NPYT+ Sbjct: 1622 TLITI*ITNCIFCIPAVIKVNKGKTWWFSSNPYTA 1518 Score = 38.6 bits (78), Expect(5) = 6e-19 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -2 / -3 Query: 711 FHCPDPQHQYADDIHEQSAQIHHIHSISYQ 622 FHC Q+Q IH Q+ Q+ HIHS S Q Sbjct: 2661 FHCQGLQNQSVSGIHVQNDQVRHIHSTSCQ 2572 Score = 34.5 bits (69), Expect(5) = 6e-19 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 / -2 Query: 422 QNSKHTKLIFKFPSSHPGIQVANIQAGHGEQIP 324 QN KH +L+ P H IQV ++ A H P Sbjct: 451 QNPKHAELVLDLPRRHARIQVPHVHASHERARP 353 Score = 25.8 bits (50), Expect(5) = 6e-19 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 / -2 Query: 870 GLVTCYSCDHGLGLEKH 820 G TC +CDHG G H Sbjct: 4099 GWYTCSACDHGNGDAMH 4049 Score = 23.5 bits (45), Expect(5) = 6e-19 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 / -1 Query: 542 QLNPPSILA 516 QLNPPSILA Sbjct: 2525 QLNPPSILA 2499 Score = 48.3 bits (99), Expect(4) = 8e-14 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = +2 / +2 Query: 410 VWSFAKCMGCT*TTWFCVY*F**QAGC*RCTS*SRW 517 V S +CMGC TT FC+Y* ** GC RC S* RW Sbjct: 1505 VVSSMQCMGC*KTTRFCLY*L**PQGCRRCNS*FRW 1612 Score = 40.9 bits (83), Expect(4) = 8e-14 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +2 / +2 Query: 623 *YEML*MW*IWALCS*MSSAYWCWGSGQWK 712 *+E+L*MW W+ C+*M W W QWK Sbjct: 2573 *HEVL*MWRTWSFCT*MPLTDWFWRPWQWK 2662 Score = 28.1 bits (55), Expect(4) = 8e-14 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 / +3 Query: 325 GICSPWPACMLATWMPG*LLGNLKMSFVCLEF 420 G W AC TW+ * G + S CL F Sbjct: 354 GRARSWLACTWGTWIRA*RRGRSRTSSACLGF 449 Score = 26.7 bits (52), Expect(4) = 8e-14 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +2 / +2 Query: 518 QEWMEG*AVSQ 550 QEWMEG*AV+Q Sbjct: 2501 QEWMEG*AVNQ 2533 Score = 33.6 bits (67), Expect(4) = 3e-06 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 / -2 Query: 673 HSRAKCPDSPHS*HFI 626 HSRAK P SPHS*HF+ Sbjct: 2623 HSRAK*PGSPHS*HFM 2576 Score = 29.5 bits (58), Expect(4) = 3e-06 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 / -2 Query: 466 INAKPGGLRATHTLRK 419 I AKPGG ATHTL + Sbjct: 1561 IKAKPGGFLATHTLHR 1514 Score = 29.0 bits (57), Expect(4) = 3e-06 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 / -3 Query: 516 HLDHEVHLQHPACH 475 HL+HE+HL HP H Sbjct: 1611 HLNHELHLLHPCGH 1570 Score = 24.9 bits (48), Expect(4) = 3e-06 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -1 / -1 Query: 865 GDLL*LRPRAGAGE 824 GDLL*LR R G G+ Sbjct: 3527 GDLL*LRSRGGGGD 3486 Score = 47.8 bits (98), Expect(2) = 4e-05 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +1 / +1 Query: 418 FCEVYGLHVNHLVLRLLILMTSGMLKMHFVI*M 516 F VYGL NH VL LL LMT+GM KM FVI*M Sbjct: 1513 FYAVYGLLENHQVLPLLTLMTAGMQKMQFVI*M 1611 Score = 25.4 bits (49), Expect(2) = 4e-05 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 / +1 Query: 517 ARMDGGLSC 543 ARMDGGLSC Sbjct: 2500 ARMDGGLSC 2526 Score = 26.7 bits (52), Expect(2) = 0.57 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 / -3 Query: 543 TAQPSIHSCHLDHEV 499 TAQPSIHSC H + Sbjct: 2526 TAQPSIHSCL*AHHI 2482 Score = 26.3 bits (51), Expect(2) = 0.57 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 / -1 Query: 662 KVPRFTTFIAFHIR 621 K+ RF TFIA H+R Sbjct: 2612 KMTRFATFIALHVR 2571
>LOC_Os06g08840:12006.t00763:unspliced-genomic splicing factor, arginine/serine-rich 7, putative, expressed| Length = 3670 Score = 74.8 bits (157), Expect(4) = 2e-40 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 / +2 Query: 426 SVWVARKPPGFAFIDFDDKRDAEDALRDLDG 518 SVWVARKPPGFAFIDFDD+RDA+DA+RD+DG Sbjct: 1166 SVWVARKPPGFAFIDFDDRRDAQDAIRDIDG 1258 Score = 65.2 bits (136), Expect(4) = 2e-40 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = +3 / +2 Query: 621 SDMKCYECGESGHFARECRLRIGAGGL 701 S+ KCYECGE+GHFARECRLRIG+GGL Sbjct: 1811 SESKCYECGETGHFARECRLRIGSGGL 1891 Score = 61.6 bits (128), Expect(4) = 2e-40 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 / +2 Query: 339 MARLYVGNLDARVTAGELEDEFRVFGVLR 425 MAR+YVGNLD RVTA ELEDEFRVFGVLR Sbjct: 347 MARVYVGNLDPRVTARELEDEFRVFGVLR 433 Score = 33.6 bits (67), Expect(4) = 2e-40 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 / +2 Query: 516 GKNGWRVELSRN 551 GKNGWRVELSRN Sbjct: 1736 GKNGWRVELSRN 1771 Score = 51.9 bits (107), Expect(6) = 8e-23 Identities = 19/32 (59%), Positives = 25/32 (78%) Frame = -2 / -3 Query: 714 AFHCPDPQHQYADDIHEQSAQIHHIHSISYQT 619 AFHC DP++Q ++ IHEQSAQ HHIH+ Q+ Sbjct: 1904 AFHCLDPRNQSSNGIHEQSAQSHHIHNTCSQS 1809 Score = 50.6 bits (104), Expect(6) = 8e-23 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = -3 / -1 Query: 509 ITKCIFSIPLVIKINKRKTRWFTCNPYTS 423 IT CI SIP VIKIN+ KT W +C+PYT+ Sbjct: 1249 ITNCILSIPPVIKINECKTWWLSCDPYTA 1163 Score = 38.6 bits (78), Expect(6) = 8e-23 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 / -1 Query: 422 QNSKHTKLIFKFPSSHPGIQVANIQAGH 339 +NSK +L+ + P H GIQV+++ AGH Sbjct: 430 KNSKDAELVLELPRRHAGIQVSDVHAGH 347 Score = 24.4 bits (47), Expect(6) = 8e-23 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 / -3 Query: 822 HCGVLESDHEGCNFFCH 772 H LES +GCNF H Sbjct: 2450 HYDALESALQGCNFCSH 2400 Score = 24.0 bits (46), Expect(6) = 8e-23 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -3 / -1 Query: 551 IARQLNPPSILA 516 I RQLN PSILA Sbjct: 1771 ITRQLNSPSILA 1736 Score = 23.1 bits (44), Expect(6) = 8e-23 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 / -3 Query: 867 LVTCYSCDH 841 +VTCYSC H Sbjct: 2489 VVTCYSCVH 2463 Score = 45.1 bits (92), Expect(4) = 1e-15 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 / +1 Query: 629 EML*MW*IWALCS*MSSAYWCWGSGQWKA 715 ++L*MW* WALCS*M W GS QWKA Sbjct: 1819 QVL*MW*DWALCS*MPFEDWFRGSRQWKA 1905 Score = 44.1 bits (90), Expect(4) = 1e-15 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +1 / +3 Query: 427 VYGLHVNHLVLRLLILMTSGMLKMHFVI*M 516 VYG +H VL LILMT GML+M FVI*M Sbjct: 1167 VYGSQESHQVLHSLILMTGGMLRMQFVI*M 1256 Score = 35.0 bits (70), Expect(4) = 1e-15 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 / +3 Query: 340 WPACMLATWMPG*LLGNLKMSFVCLEF 420 WPAC TW+P * G+ + S LEF Sbjct: 348 WPACTSETWIPA*RRGSSRTSSASLEF 428 Score = 25.8 bits (50), Expect(4) = 1e-15 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +1 / +3 Query: 517 ARMDGGLSCLAM 552 ARMDG LSCL M Sbjct: 1737 ARMDGELSCLVM 1772 Score = 36.3 bits (73), Expect(6) = 3e-10 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 / -2 Query: 673 HSRAKCPDSPHS*HFI 626 HSRAKCP SPHS*H + Sbjct: 1863 HSRAKCPVSPHS*HLL 1816 Score = 31.8 bits (63), Expect(6) = 3e-10 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -2 / -3 Query: 516 HLDHEVHLQHPACH 475 HL HE+H +HP+CH Sbjct: 1256 HLYHELHPEHPSCH 1215 Score = 29.9 bits (59), Expect(6) = 3e-10 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 / -2 Query: 466 INAKPGGLRATHTL 425 +NAKPGG ATHTL Sbjct: 1206 MNAKPGGFLATHTL 1165 Score = 23.5 bits (45), Expect(6) = 3e-10 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -2 / -3 Query: 546 ETAQPSIHSC 517 ETAQ SIHSC Sbjct: 1766 ETAQLSIHSC 1737 Score = 23.1 bits (44), Expect(6) = 3e-10 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 / -2 Query: 865 GDLL*LRPRAG 833 GDLL*LR RAG Sbjct: 2487 GDLL*LRARAG 2455 Score = 22.6 bits (43), Expect(6) = 3e-10 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 / -1 Query: 821 TAASWRAITRAVTSS 777 T WRA RAVTS+ Sbjct: 2449 TTTPWRAPCRAVTSA 2405 Score = 41.8 bits (85), Expect(2) = 0.008 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +2 / +1 Query: 425 KCMGCT*TTWFCVY*F**QAGC*RCTS*SRW 517 +CMG T FC++*F**Q GC C S* RW Sbjct: 1165 QCMGRKKATRFCIH*F**QEGCSGCNS*YRW 1257 Score = 23.1 bits (44), Expect(2) = 0.008 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 / +1 Query: 518 QEWMEG*AVS 547 QEWME *AVS Sbjct: 1738 QEWMES*AVS 1767
>LOC_Os03g61990:12003.t05427:unspliced-genomic glycine-rich RNA-binding protein 8, putative, expressed| Length = 3234 Score = 38.6 bits (78), Expect(2) = 2e-04 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +3 / +3 Query: 633 CYECGESGHFARECRLRIGAG 695 CY+CG+ GHFAREC G G Sbjct: 1761 CYKCGKPGHFARECPSGDGGG 1823 Score = 31.8 bits (63), Expect(2) = 2e-04 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 / +3 Query: 453 GFAFIDFDDKRDAEDALRDLDG 518 GF F+ FD+K+ EDA+ ++G Sbjct: 1524 GFGFVTFDEKKAMEDAIEGMNG 1589
>LOC_Os01g06290:12001.t00512:unspliced-genomic splicing factor, arginine/serine-rich 4, putative, expressed| Length = 2918 Score = 34.1 bits (68), Expect(3) = 2e-04 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 / +1 Query: 630 KCYECGESGHFARECR 677 +CY CG+ GH R+CR Sbjct: 1708 RCYRCGDRGHIERDCR 1755 Score = 29.0 bits (57), Expect(3) = 2e-04 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 / +3 Query: 345 RLYVGNLDARVTAGELEDEFRVFG 416 RLYVG L +R +LED F +G Sbjct: 414 RLYVGRLSSRTRTRDLEDLFGRYG 485 Score = 26.7 bits (52), Expect(3) = 2e-04 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 / +1 Query: 468 DFDDKRDAEDALRDLDGKN 524 +F D RDA++A +LDG++ Sbjct: 1354 EFSDARDADEARYNLDGRD 1410 Score = 31.8 bits (63), Expect = 9.3 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 / +1 Query: 630 KCYECGESGHFARECR 677 +C+ CG GH+AR+C+ Sbjct: 1642 RCFNCGIDGHWARDCK 1689
>LOC_Os05g07000:12005.t00589:unspliced-genomic splicing factor RSZ33, putative, expressed| Length = 4234 Score = 34.5 bits (69), Expect(2) = 0.016 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 / +1 Query: 630 KCYECGESGHFARECR 677 +CY CGE GH REC+ Sbjct: 2629 RCYGCGERGHILRECK 2676 Score = 29.5 bits (58), Expect(2) = 0.016 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 / +3 Query: 468 DFDDKRDAEDALRDLDGK 521 +F D RDA DA DLDG+ Sbjct: 2193 EFSDPRDANDARLDLDGR 2246
>LOC_Os02g13750:12002.t01171:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8165 Score = 40.5 bits (82), Expect = 0.022 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S++KC+ECGE GHFA +C Sbjct: 820 SNLKCFECGEKGHFASKC 873
>LOC_Os03g22100:12003.t01962:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 3740 Score = 40.0 bits (81), Expect = 0.031 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 / +3 Query: 627 MKCYECGESGHFARECRLR 683 M C+ECG+ GHFAR CR + Sbjct: 912 MSCFECGKPGHFARNCRYK 968
>LOC_Os02g33340:12002.t02977:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 4025 Score = 40.0 bits (81), Expect = 0.031 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 / +3 Query: 627 MKCYECGESGHFARECRLR 683 M C+ECG+ GHFAR CR + Sbjct: 816 MSCFECGKPGHFARNCRYK 872
>LOC_Os08g03520:12008.t00246:unspliced-genomic glycine-rich protein 2b, putative, expressed| Length = 1018 Score = 39.6 bits (80), Expect = 0.042 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 / +2 Query: 633 CYECGESGHFARECRLRIGAGG 698 CY+CGE GH AR+C G GG Sbjct: 497 CYKCGEEGHMARDCSQGGGGGG 562 Score = 36.8 bits (74), Expect = 0.28 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 / +2 Query: 633 CYECGESGHFAREC 674 CY CGE+GH AREC Sbjct: 623 CYNCGETGHIAREC 664
>LOC_Os07g20560:12007.t01860:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4709 Score = 39.6 bits (80), Expect = 0.042 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECRLRIGAG 695 S+++C+ECGE GHFA +C + G Sbjct: 1234 SNLRCFECGEKGHFASKCPSKANDG 1308
>LOC_Os05g02880:12005.t00186:unspliced-genomic splicing factor, arginine/serine-rich 7, putative, expressed| Length = 3489 Score = 34.1 bits (68), Expect(2) = 0.044 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 / +2 Query: 630 KCYECGESGHFARECR 677 KCY CGE GH R C+ Sbjct: 2402 KCYRCGERGHIERNCQ 2449 Score = 28.1 bits (55), Expect(2) = 0.044 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 / +2 Query: 468 DFDDKRDAEDALRDLDGKN 524 +F D RDAE+A +LDG++ Sbjct: 2048 EFSDPRDAEEARYNLDGRD 2104 Score = 31.8 bits (63), Expect = 9.3 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 / +2 Query: 630 KCYECGESGHFARECR 677 +C+ CG GH+AR+C+ Sbjct: 2336 RCFNCGIDGHWARDCK 2383
>LOC_Os12g43260:12012.t03995:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2620 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 1752 SNLRCFECGEKGHFASKC 1805
>LOC_Os12g22180:12012.t01957:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1239 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os12g12450:12012.t01114:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5104 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os10g22230:12010.t01706:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1388 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 621 SNLRCFECGEKGHFASKC 674
>LOC_Os10g20660:12010.t01559:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5177 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os10g13410:12010.t01071:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2686 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +2 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 2591 SNLRCFECGEKGHFASKC 2644
>LOC_Os10g03070:12010.t00196:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 11487 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os09g07850:12009.t00581:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 9742 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 3310 SNLRCFECGEKGHFASKC 3363
>LOC_Os08g16760:12008.t01548:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3240 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 2875 SNLRCFECGEKGHFASKC 2928 Score = 36.3 bits (73), Expect = 0.39 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 / +2 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE G+FA +C Sbjct: 701 SNLRCFECGEKGYFASKC 754
>LOC_Os07g23220:12007.t02023:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4793 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 457 SNLRCFECGEKGHFASKC 510
>LOC_Os07g08960:12007.t00771:unspliced-genomic glycine-rich RNA-binding protein 7, putative, expressed| Length = 3826 Score = 39.1 bits (79), Expect = 0.058 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 / +2 Query: 633 CYECGESGHFARECRLRIGAGG 698 C++CG +GH+AREC G GG Sbjct: 2357 CFKCGRAGHWARECPYSSGGGG 2422
>LOC_Os07g08950:12007.t00770:unspliced-genomic D-2-hydroxyglutarate dehydrogenase, mitochondrial precursor,| putative, expressed Length = 7631 Score = 39.1 bits (79), Expect = 0.058 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 / -1 Query: 633 CYECGESGHFARECRLRIGAGG 698 C++CG +GH+AREC G GG Sbjct: 7595 CFKCGRAGHWARECPYSSGGGG 7530
>LOC_Os06g49910:12006.t04675:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5178 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os06g39920:12006.t03689:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4197 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os06g25880:12006.t02395:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5023 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 724 SNLRCFECGEKGHFASKC 777
>LOC_Os05g44870:12005.t03975:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2070 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os05g19550:12005.t01721:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5090 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 745 SNLRCFECGEKGHFASKC 798
>LOC_Os05g17540:12005.t01523:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5172 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os05g13730:12005.t01151:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5776 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os05g02270:12005.t00126:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1386 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os04g32750:12004.t02953:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8295 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os04g26290:12004.t02336:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5167 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 814 SNLRCFECGEKGHFASKC 867
>LOC_Os03g49980:12003.t04344:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 9959 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os03g44470:12003.t03835:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5018 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os03g32600:12003.t02851:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7863 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os03g24190:12003.t02114:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8221 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 819 SNLRCFECGEKGHFASKC 872
>LOC_Os03g12600:12003.t01059:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8157 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os02g34350:12002.t03074:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5318 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 2473 SNLRCFECGEKGHFASKC 2526
>LOC_Os02g29260:12002.t02620:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5091 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os02g18900:12002.t01683:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5178 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 819 SNLRCFECGEKGHFASKC 872
>LOC_Os02g10270:12002.t00875:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8160 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os01g61490:12001.t05528:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7569 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 817 SNLRCFECGEKGHFASKC 870
>LOC_Os01g27550:12001.t02457:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5170 Score = 39.1 bits (79), Expect = 0.058 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 820 SNLRCFECGEKGHFASKC 873
>LOC_Os07g30050:12007.t02695:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3058 Score = 36.8 bits (74), Expect(2) = 0.071 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 / +3 Query: 633 CYECGESGHFARECRLRI 686 CY+CGE GH+AR C ++ Sbjct: 1797 CYDCGEQGHYARNCPWKV 1850 Score = 24.4 bits (47), Expect(2) = 0.071 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 / +3 Query: 895 LKGIAAAGVRSEACVRCMFSARSYSLALP 981 L G+ +AC RC + SL LP Sbjct: 2211 LNSFMERGMEFKACTRCGIVGHTASLCLP 2297
>LOC_Os10g01600:12010.t00057:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4876 Score = 38.6 bits (78), Expect = 0.079 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHFA +C Sbjct: 523 SNLRCFECGEKGHFALKC 576
>LOC_Os06g11460:12006.t01023:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5119 Score = 38.6 bits (78), Expect = 0.079 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFAREC 674 S++KC+ECGE GHF +C Sbjct: 828 SNLKCFECGEKGHFTSKC 881
>LOC_Os04g56880:12004.t05155:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1388 Score = 38.6 bits (78), Expect = 0.079 Identities = 11/18 (61%), Positives = 17/18 (94%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE+GHFA +C Sbjct: 621 SNLRCFECGENGHFACKC 674
>LOC_Os02g02870:12002.t00187:unspliced-genomic glycine-rich protein 2, putative, expressed| Length = 1342 Score = 38.6 bits (78), Expect = 0.079 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 / +1 Query: 633 CYECGESGHFARECRLRIGAGG 698 CY CGE+GH AR+C G GG Sbjct: 697 CYNCGETGHLARDCYNGGGGGG 762 Score = 37.7 bits (76), Expect = 0.15 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +3 / +1 Query: 624 DMKCYECGESGHFAREC 674 D CY CGE+GH AR+C Sbjct: 787 DRSCYNCGEAGHIARDC 837 Score = 36.3 bits (73), Expect = 0.39 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 / +1 Query: 633 CYECGESGHFARECRLRIGAGG 698 C++CGE GH AR+C G GG Sbjct: 601 CFKCGEMGHMARDCFNSGGGGG 666 Score = 35.4 bits (71), Expect = 0.73 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C++CGESGH AR+C Sbjct: 496 CFKCGESGHMARDC 537
>LOC_Os01g22954:12001.t02024:unspliced-genomic SCPL33, putative, expressed| Length = 19207 Score = 33.1 bits (66), Expect(2) = 0.081 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 / +2 Query: 630 KCYECGESGHFARECR 677 +C+ CGE GH R+CR Sbjct: 15590 ECFNCGEMGHLMRDCR 15637 Score = 30.4 bits (60), Expect(2) = 0.081 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 / +2 Query: 90 PTNGAPAPRRRSPLGFCVC 146 P+N + P R +P+G CVC Sbjct: 13517 PSNASTTPVRHTPVGLCVC 13573
>LOC_Os05g51890:12005.t04614:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1546 Score = 35.4 bits (71), Expect(2) = 0.095 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 633 CYECGESGHFARECRLRIGA 692 CY+CGE GH+ R C ++ A Sbjct: 188 CYDCGEQGHYVRNCPWKVFA 247 Score = 24.4 bits (47), Expect(2) = 0.095 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 / +2 Query: 895 LKGIAAAGVRSEACVRCMFSARSYSLALP 981 L G+ +AC RC + SL LP Sbjct: 596 LNSFMERGLEFKACTRCGIVGHTASLCLP 682
>LOC_Os03g17710:12003.t01545:unspliced-genomic splicing factor, arginine/serine-rich 6, putative, expressed| Length = 3332 Score = 34.1 bits (68), Expect(2) = 0.10 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 / +2 Query: 630 KCYECGESGHFARECR 677 KCY CGE GH R C+ Sbjct: 2180 KCYRCGERGHIERNCQ 2227 Score = 26.7 bits (52), Expect(2) = 0.10 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 / +3 Query: 468 DFDDKRDAEDALRDLDGKN 524 +F D RDA++A +LDG++ Sbjct: 1815 EFSDPRDADEARYNLDGRD 1871 Score = 31.8 bits (63), Expect = 9.3 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 / +2 Query: 630 KCYECGESGHFARECR 677 +C+ CG GH+AR+C+ Sbjct: 2114 RCFNCGIDGHWARDCK 2161
>LOC_Os08g38640:12008.t03599:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4297 Score = 38.2 bits (77), Expect = 0.11 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C E GHFAR+CR Sbjct: 901 SKVKCFNCDEFGHFARQCR 957
>LOC_Os07g34410:12007.t03117:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 4400 Score = 38.2 bits (77), Expect = 0.11 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C E GHFAR+CR Sbjct: 279 SKVKCFNCDEFGHFARQCR 335
>LOC_Os07g19200:12007.t01776:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7356 Score = 38.2 bits (77), Expect = 0.11 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+ +C+ECGE GHFA +C Sbjct: 823 SNFRCFECGEKGHFASKC 876
>LOC_Os06g43540:12006.t04044:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 4384 Score = 38.2 bits (77), Expect = 0.11 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C E GHFAR+CR Sbjct: 901 SKVKCFNCDEFGHFARQCR 957
>LOC_Os05g36940:12005.t03238:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4308 Score = 38.2 bits (77), Expect = 0.11 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C E GHFAR+CR Sbjct: 901 SKVKCFNCDEFGHFARQCR 957
>LOC_Os04g02870:12004.t00181:unspliced-genomic arginine/serine-rich splicing factor RSP41, putative, expressed| Length = 4409 Score = 38.2 bits (77), Expect = 0.11 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = +3 / +3 Query: 453 GFAFIDFDDKRDAEDALRDLDG 518 GFAF+ F+D+RD ++A+R LDG Sbjct: 1416 GFAFVYFEDERDGDEAIRALDG 1481
>LOC_Os03g18720:12003.t01642:unspliced-genomic spliceosomal protein, putative, expressed| Length = 4468 Score = 38.2 bits (77), Expect = 0.11 Identities = 17/57 (29%), Positives = 31/57 (54%) Frame = +3 / +3 Query: 348 LYVGNLDARVTAGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG 518 L++ NL A T+ L+ F+ + R V + PG AF++++D + A++ L G Sbjct: 3756 LFIQNLPAETTSMMLQILFQQYPGFREVRMIEAKPGIAFVEYEDDSQSMVAMQALQG 3926
>LOC_Os01g66379:12001.t05998:unspliced-genomic expressed protein| Length = 12803 Score = 38.2 bits (77), Expect = 0.11 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+ +C+ECGE GHFA +C Sbjct: 3595 SNFRCFECGEKGHFASKC 3648
>LOC_Os01g60560:12001.t05437:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1546 Score = 35.0 bits (70), Expect(2) = 0.13 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 633 CYECGESGHFARECRLRIGA 692 CY+CGE GH+ R C ++ A Sbjct: 188 CYDCGEQGHYIRNCPWKVFA 247 Score = 24.4 bits (47), Expect(2) = 0.13 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 / +2 Query: 895 LKGIAAAGVRSEACVRCMFSARSYSLALP 981 L G+ +AC RC + SL LP Sbjct: 596 LNSFMERGLEFKACARCGIVGHTASLCLP 682
>LOC_Os12g29900:12012.t02699:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1246 Score = 37.7 bits (76), Expect = 0.15 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 ++++C+ECGE GHFA +C Sbjct: 745 TNLRCFECGEKGHFASKC 798
>LOC_Os04g22920:12004.t02020:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 949 Score = 37.7 bits (76), Expect = 0.15 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 / +2 Query: 621 SDMKCYECGESGHFARECR 677 S MKC+ C E GH+A++CR Sbjct: 314 SKMKCFNCNEYGHYAKQCR 370
>LOC_Os09g17170:12009.t01504:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1555 Score = 35.4 bits (71), Expect(2) = 0.17 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 633 CYECGESGHFARECRLRIGA 692 CY+CGE GH+ R C ++ A Sbjct: 188 CYDCGEQGHYVRNCPWKVFA 247 Score = 23.5 bits (45), Expect(2) = 0.17 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +1 / +2 Query: 919 VRSEACVRCMFSARSYSLALPARSTET*RQLLDFC 1023 ++ +AC RC + SL LP LD C Sbjct: 629 LKFKACARCGIVGHTASLCLPTCRCGEYTHYLDAC 733
>LOC_Os12g15580:12012.t01413:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 828 Score = 37.3 bits (75), Expect = 0.21 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHF +C Sbjct: 745 SNLRCFECGEKGHFVSKC 798
>LOC_Os11g23060:12011.t01976:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 9324 Score = 37.3 bits (75), Expect = 0.21 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 / +1 Query: 624 DMKCYECGESGHFARECRLRIGAGG 698 D CY CG+ GHFAR C R GG Sbjct: 4195 DSPCYVCGKFGHFARLCPNRQNMGG 4269
>LOC_Os11g20239:12011.t01793:unspliced-genomic expressed protein| Length = 20374 Score = 37.3 bits (75), Expect = 0.21 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 / +2 Query: 624 DMKCYECGESGHFAREC 674 D CY CG++GHFAR+C Sbjct: 8087 DSPCYVCGKTGHFARQC 8137
>LOC_Os07g24690:12007.t02165:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2938 Score = 37.3 bits (75), Expect = 0.21 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 / +1 Query: 624 DMKCYECGESGHFARECRLRIGAGG 698 D CY CG+ GHFAR C R GG Sbjct: 40 DSPCYVCGKIGHFARLCPNRQNMGG 114
>LOC_Os06g21990:12006.t02015:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3637 Score = 37.3 bits (75), Expect = 0.21 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 / +2 Query: 624 DMKCYECGESGHFARECRLRIGAGG 698 D CY CG+ GHFAR C R GG Sbjct: 1361 DSPCYVCGKIGHFARLCPNRQNMGG 1435
>LOC_Os05g40930:12005.t03632:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1468 Score = 37.3 bits (75), Expect = 0.21 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 / +1 Query: 624 DMKCYECGESGHFARECRLRIGAGG 698 D CY CG+ GHFAR C R GG Sbjct: 814 DSPCYVCGKIGHFARLCPNRQNMGG 888
>LOC_Os04g29380:12004.t02631:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5604 Score = 37.3 bits (75), Expect = 0.21 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C E GH+AR+CR Sbjct: 892 SQVKCFNCDEFGHYARQCR 948
>LOC_Os04g01439:12004.t00043:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 10296 Score = 37.3 bits (75), Expect = 0.21 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = +3 / +2 Query: 624 DMKCYECGESGHFAREC 674 +++C+ECGE GHFA +C Sbjct: 2942 NLRCFECGEKGHFASKC 2992
>LOC_Os04g01120:12004.t00012:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2948 Score = 37.3 bits (75), Expect = 0.21 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 / +1 Query: 624 DMKCYECGESGHFARECRLRIGAGG 698 D CY CG+ GHFAR C R GG Sbjct: 40 DSPCYVCGKIGHFARLCPNRQNMGG 114
>LOC_Os02g45680:12002.t04155:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8006 Score = 37.3 bits (75), Expect = 0.21 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 / +2 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE GHF +C Sbjct: 662 SNLRCFECGEKGHFVSKC 715
>LOC_Os01g49300:12001.t04369:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4199 Score = 37.3 bits (75), Expect = 0.21 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C E GH+AR+CR Sbjct: 769 SKVKCFNCNEYGHYARQCR 825
>LOC_Os08g21940:12008.t01982:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2589 Score = 34.5 bits (69), Expect(2) = 0.27 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY+CGE GH+ R C Sbjct: 1768 CYDCGEQGHYVRNC 1809 Score = 24.4 bits (47), Expect(2) = 0.27 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 / +1 Query: 895 LKGIAAAGVRSEACVRCMFSARSYSLALP 981 L G+ +AC RC + SL LP Sbjct: 2185 LNSFMERGLEFKACTRCGIVGHTASLCLP 2271
>LOC_Os08g32590:12008.t03004:unspliced-genomic zinc knuckle family protein, expressed| Length = 1387 Score = 36.8 bits (74), Expect = 0.28 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 / +2 Query: 633 CYECGESGHFARECR 677 CY CGE GH AR+CR Sbjct: 1004 CYNCGEPGHIARDCR 1048
>LOC_Os03g42950:12003.t03695:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass, expressed| Length = 3681 Score = 36.8 bits (74), Expect = 0.28 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 / +1 Query: 624 DMKCYECGESGHFARECRLRIGAGG 698 D CY CG GHFAR C R GG Sbjct: 619 DSPCYVCGNIGHFARLCPNRQNMGG 693
>LOC_Os03g28010:12003.t02474:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 9930 Score = 36.8 bits (74), Expect = 0.28 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFAREC 674 S++KC+ECGE HFA +C Sbjct: 5577 SNLKCFECGEKRHFASKC 5630
>LOC_Os02g22810:12002.t02068:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1368 Score = 35.4 bits (71), Expect(2) = 0.38 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / +1 Query: 633 CYECGESGHFARECRLRIGA 692 CY+CGE GH+ R C ++ A Sbjct: 277 CYDCGEQGHYVRNCPWKVFA 336 Score = 22.1 bits (42), Expect(2) = 0.38 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 919 VRSEACVRCMFSARSYSLALP 981 ++ +AC RC + SL LP Sbjct: 718 LKFKACARCGIVGHTASLCLP 780
>LOC_Os08g12560:12008.t01135:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1926 Score = 35.4 bits (71), Expect(2) = 0.38 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / +1 Query: 633 CYECGESGHFARECRLRIGA 692 CY+CGE GH+ R C ++ A Sbjct: 850 CYDCGEQGHYVRNCPWKVFA 909 Score = 22.6 bits (43), Expect(2) = 0.38 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 919 VRSEACVRCMFSARSYSLALP 981 ++ +AC RC + SL LP Sbjct: 1291 LKCKACARCGIVGHTASLCLP 1353
>LOC_Os12g37810:12012.t03462:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8474 Score = 36.3 bits (73), Expect = 0.39 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 / +2 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+EC E GHFA +C Sbjct: 1091 SNLRCFECSEKGHFASKC 1144
>LOC_Os11g36480:12011.t03195:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 2364 Score = 36.3 bits (73), Expect = 0.39 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 / +3 Query: 633 CYECGESGHFAREC 674 CY+CGE GHFAR C Sbjct: 1635 CYKCGEEGHFARGC 1676
>LOC_Os10g04074:12010.t00296:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 7799 Score = 36.3 bits (73), Expect = 0.39 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C E GH+AR+CR Sbjct: 1005 SRVKCFNCDEFGHYARQCR 1061
>LOC_Os07g39170:12007.t03578:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5173 Score = 36.3 bits (73), Expect = 0.39 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE G+FA +C Sbjct: 820 SNLRCFECGEKGYFASKC 873
>LOC_Os06g02740:12006.t00167:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2521 Score = 36.3 bits (73), Expect = 0.39 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE G+FA +C Sbjct: 823 SNLRCFECGEKGYFASKC 876
>LOC_Os04g54450:12004.t04917:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4278 Score = 36.3 bits (73), Expect = 0.39 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C E GH+AR+CR Sbjct: 886 SRVKCFNCDEFGHYARQCR 942
>LOC_Os03g36370:12003.t03107:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4253 Score = 36.3 bits (73), Expect = 0.39 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+EC E GHFA +C Sbjct: 3924 SNLRCFECSEKGHFASKC 3977
>LOC_Os02g27160:12002.t02410:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3141 Score = 36.3 bits (73), Expect = 0.39 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C + GHFAR+CR Sbjct: 403 SKVKCFNCEQYGHFARQCR 459
>LOC_Os01g15690:12001.t01420:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5189 Score = 36.3 bits (73), Expect = 0.39 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 / +2 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C E GH+AR+CR Sbjct: 1793 SRVKCFNCDEFGHYARQCR 1849
>LOC_Os04g21090:12004.t01843:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1555 Score = 35.4 bits (71), Expect(2) = 0.42 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 633 CYECGESGHFARECRLRIGA 692 CY+CGE GH+ R C ++ A Sbjct: 188 CYDCGEQGHYVRNCPWKVFA 247 Score = 22.1 bits (42), Expect(2) = 0.42 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 / +2 Query: 919 VRSEACVRCMFSARSYSLALP 981 ++ +AC RC + SL LP Sbjct: 629 LKFKACARCGIVGHTASLCLP 691
>LOC_Os04g16860:12004.t01441:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1755 Score = 35.4 bits (71), Expect(2) = 0.47 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / +1 Query: 633 CYECGESGHFARECRLRIGA 692 CY+CGE GH+ R C ++ A Sbjct: 388 CYDCGEQGHYVRNCPWKVFA 447 Score = 22.1 bits (42), Expect(2) = 0.47 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 919 VRSEACVRCMFSARSYSLALP 981 ++ +AC RC + SL LP Sbjct: 829 LKFKACARCGIVGHTASLCLP 891
>LOC_Os09g04150:12009.t00311:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1546 Score = 35.4 bits (71), Expect(2) = 0.57 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 633 CYECGESGHFARECRLRIGA 692 CY+CGE GH+ R C ++ A Sbjct: 188 CYDCGEQGHYVRNCPWKVFA 247 Score = 21.7 bits (41), Expect(2) = 0.57 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 / +2 Query: 919 VRSEACVRCMFSARSYSLALP 981 ++ +AC RC + SL LP Sbjct: 620 LKFKACTRCGVVGHTASLCLP 682
>LOC_Os12g01090:12012.t00008:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6321 Score = 35.4 bits (71), Expect = 0.73 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C E GH++R+CR Sbjct: 2899 SKVKCFNCDEFGHYSRQCR 2955
>LOC_Os11g01090:12011.t00009:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6321 Score = 35.4 bits (71), Expect = 0.73 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C E GH++R+CR Sbjct: 2899 SKVKCFNCDEFGHYSRQCR 2955
>LOC_Os08g29980:12008.t02751:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 5041 Score = 35.4 bits (71), Expect = 0.73 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 / +3 Query: 630 KCYECGESGHFARECRLRI 686 KC CG+ GH+A+ECR R+ Sbjct: 1278 KCRYCGKKGHWAKECRSRL 1334
>LOC_Os06g01010:12006.t00001:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5563 Score = 35.4 bits (71), Expect = 0.73 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 633 CYECGESGHFARECRLRIGA 692 CY+CGE GH+ R C ++ A Sbjct: 4727 CYDCGEQGHYVRNCPWKVFA 4786
>LOC_Os05g18310:12005.t01598:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1555 Score = 35.4 bits (71), Expect = 0.73 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 633 CYECGESGHFARECRLRIGA 692 CY+CGE GH+ R C ++ A Sbjct: 188 CYDCGEQGHYVRNCPWKVFA 247
>LOC_Os02g21560:12002.t01945:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6386 Score = 35.4 bits (71), Expect = 0.73 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+ECGE G FA +C Sbjct: 820 SNLRCFECGEKGQFASKC 873
>LOC_Os01g33740:12001.t02939:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5844 Score = 35.4 bits (71), Expect = 0.73 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / -3 Query: 633 CYECGESGHFARECRLRIGA 692 CY+CGE GH+ R C ++ A Sbjct: 5581 CYDCGEQGHYVRNCPWKVFA 5522
>LOC_Os11g30200:12011.t02624:unspliced-genomic expressed protein| Length = 2340 Score = 28.1 bits (55), Expect(2) = 0.81 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 / +2 Query: 633 CYECGESGHFARECRLRI 686 C C E GH AR+C +I Sbjct: 608 CLRCKERGHLARDCCTKI 661 Score = 24.4 bits (47), Expect(2) = 0.81 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 / +1 Query: 680 AYWCWGSGQW 709 A W WGSG W Sbjct: 739 ASWIWGSGIW 768
>LOC_Os10g24640:12010.t01889:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3797 Score = 35.0 bits (70), Expect = 1.0 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFARECRL 680 S +KC+ C E GH++++CR+ Sbjct: 1572 SKVKCFNCDEYGHYSKQCRM 1631
>LOC_Os09g37720:12009.t03246:unspliced-genomic RNA binding protein, putative, expressed| Length = 992 Score = 35.0 bits (70), Expect = 1.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 / +1 Query: 630 KCYECGESGHFAREC 674 +CYECGE GH + EC Sbjct: 496 RCYECGEEGHLSYEC 540
>LOC_Os09g34070:12009.t02983:unspliced-genomic FPA, putative, expressed| Length = 7535 Score = 35.0 bits (70), Expect = 1.0 Identities = 19/57 (33%), Positives = 26/57 (45%) Frame = +3 / +2 Query: 348 LYVGNLDARVTAGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG 518 L+VGNL A+ ++ F G L V P +AF+ F +A AL L G Sbjct: 254 LWVGNLPAQAAEDDVMASFSPHGALDCVMARAGPRSYAFVLFRSVPEARAALDALQG 424 Score = 31.3 bits (62), Expect(2) = 5.5 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +3 / +1 Query: 315 DCSRDLFTMARLYVGNLDARVTAGELEDEFRVFGVLRSVWVAR 443 D S + L+VG + + ++ ELE+EF+ FG + + +R Sbjct: 1288 DLSFQARAVKNLWVGGISSSISKEELEEEFKKFGKVDGIAFSR 1416 Score = 24.4 bits (47), Expect(2) = 5.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +3 / +3 Query: 456 FAFIDFDDKRDAEDALRDLDGK 521 +AF++F +A +A ++LDG+ Sbjct: 1947 YAFVEFATVGEASNAKKNLDGR 2012
>LOC_Os08g33040:12008.t03047:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7997 Score = 35.0 bits (70), Expect = 1.0 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFA 665 S+++C+ECGE GHFA Sbjct: 820 SNLRCFECGEKGHFA 864
>LOC_Os05g26970:12005.t02351:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5142 Score = 35.0 bits (70), Expect = 1.0 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+EC E GHFA +C Sbjct: 784 SNLRCFECCEKGHFASKC 837
>LOC_Os04g20840:12004.t01818:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2578 Score = 35.0 bits (70), Expect = 1.0 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFA 665 S+++C+ECGE GHFA Sbjct: 820 SNLRCFECGEKGHFA 864
>LOC_Os03g16420:12003.t01426:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 924 Score = 35.0 bits (70), Expect = 1.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 / +1 Query: 630 KCYECGESGHFAREC 674 KC++CGE GH AR C Sbjct: 817 KCFDCGERGHMARNC 861
>LOC_Os01g17279:12001.t01573:unspliced-genomic histone mRNA exonuclease 1, putative, expressed| Length = 11188 Score = 35.0 bits (70), Expect = 1.0 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 / +1 Query: 883 ILLMLKGIAAAGVRSEACVRCMFSARSYS 969 +++ +G+AAAGV E C CMFS + S Sbjct: 4954 LVIPTRGVAAAGVLLEGCAHCMFSQQQPS 5040
>LOC_Os05g02040:12005.t00103:unspliced-genomic DNA binding protein, putative, expressed| Length = 4713 Score = 31.8 bits (63), Expect(2) = 1.1 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +3 / +3 Query: 627 MKCYECGESGHFARECRLRIGAG 695 ++C++C + GHF+R+C ++ G Sbjct: 4056 LECFKCKQPGHFSRDCPVQSTGG 4124 Score = 25.8 bits (50), Expect(2) = 1.1 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 / +3 Query: 123 SPLGFCVCFPHEDRKYLDVESSRSFC 200 SPLG +C KYL V + FC Sbjct: 753 SPLGCSLCKDANATKYLSVTTLLGFC 830 Score = 31.8 bits (63), Expect = 9.3 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +3 / +3 Query: 630 KCYECGESGHFAREC 674 +CY+C + GH+AR+C Sbjct: 3990 ECYKCKQPGHYARDC 4034
>LOC_Os10g16520:12010.t01217:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1773 Score = 32.2 bits (64), Expect(2) = 1.2 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 / +1 Query: 633 CYECGESGHFARECRLRIGA 692 CY+CGE H+ R C ++ A Sbjct: 397 CYDCGEQDHYVRNCPWKVFA 456 Score = 24.0 bits (46), Expect(2) = 1.2 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 / +1 Query: 895 LKGIAAAGVRSEACVRCMFSARSYSLALP 981 L G+ +AC RC + SL LP Sbjct: 823 LNSFMERGLEFKACTRCGIVEHTASLCLP 909
>LOC_Os04g20960:12004.t005550:unspliced-genomic expressed protein| Length = 33278 Score = 30.4 bits (60), Expect(2) = 1.4 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 / +2 Query: 624 DMKCYECGESGHFARECR 677 D C CG+ GH+A++CR Sbjct: 21572 DDACRSCGKLGHWAKDCR 21625 Score = 29.5 bits (58), Expect(2) = 1.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 / +2 Query: 385 GNLKMSFVCLEFCEVYGLHVNHLVLRLLILM 477 G+L F CL +C + ++ HLV ++LM Sbjct: 12005 GHLSYFFECLVWCHSFEYYLTHLVQNKVLLM 12097
>LOC_Os11g11860:12011.t01073:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3112 Score = 34.5 bits (69), Expect = 1.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 / +2 Query: 624 DMKCYECGESGHFARECR 677 D KC CG+ GH+A+ECR Sbjct: 2021 DDKCRNCGKLGHWAKECR 2074
>LOC_Os08g31920:12008.t02937:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 2328 Score = 34.5 bits (69), Expect = 1.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 / +1 Query: 630 KCYECGESGHFARECR 677 KCY CG GH +R+CR Sbjct: 841 KCYNCGVRGHLSRDCR 888
>LOC_Os07g18050:12007.t01664:unspliced-genomic pre-mRNA-splicing factor SLT11, putative, expressed| Length = 4470 Score = 34.5 bits (69), Expect = 1.4 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 / +2 Query: 348 LYVGNLDARVTAGELEDEFRVFGVLRSV 431 LY+G LD+RVT +L D+F G + ++ Sbjct: 3473 LYIGGLDSRVTEQDLRDQFYAHGEIETI 3556
>LOC_Os06g40980:12006.t03793:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 3474 Score = 34.5 bits (69), Expect = 1.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 / +1 Query: 624 DMKCYECGESGHFARECRLRIG 689 +M C+ CG+ GH AR+C R G Sbjct: 328 EMTCFVCGQPGHLARKCPQRKG 393
>LOC_Os05g29120:12005.t02561:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5739 Score = 34.5 bits (69), Expect = 1.4 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 / +1 Query: 633 CYECGESGHFARECR 677 C+ CGE GHFA +CR Sbjct: 2200 CFNCGEYGHFANKCR 2244
>LOC_Os05g22614:12005.t01921:unspliced-genomic expressed protein| Length = 5962 Score = 34.5 bits (69), Expect = 1.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 / +2 Query: 630 KCYECGESGHFARECR 677 KCY CG GH +R+CR Sbjct: 2747 KCYNCGVRGHLSRDCR 2794
>LOC_Os02g42040:12002.t03791:unspliced-genomic regulator of nonsense transcripts 2, putative, expressed| Length = 11018 Score = 34.5 bits (69), Expect = 1.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 / +2 Query: 87 PPTNGAPAPRRRSPLGFCVCFPH 155 P T +PA SP G C CFPH Sbjct: 113 PATRSSPATAAPSPAGTCPCFPH 181
>LOC_Os02g28160:12002.t02510:unspliced-genomic hypothetical protein| Length = 676 Score = 34.5 bits (69), Expect = 1.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 / +2 Query: 633 CYECGESGHFARECRLRIGAGGL 701 CY+CGE GH+ R C ++ A L Sbjct: 188 CYDCGE*GHYVRNCPWKVFARSL 256
>LOC_Os01g24400:12001.t02161:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4975 Score = 34.5 bits (69), Expect = 1.4 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++ +ECGE GHFA +C Sbjct: 622 SNLRVFECGEKGHFASKC 675
>LOC_Os06g13570:12006.t01232:unspliced-genomic expressed protein| Length = 8603 Score = 34.5 bits (69), Expect = 1.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 / -2 Query: 272 CCCFSWIGFEVFL*RLLSGSVHHGPLVCWQLGC 370 CC F W+G V+L*R + S++ ++C C Sbjct: 3376 CCTFGWVGVGVYL*RHPTFSLYLNEMICRSPAC 3278
>LOC_Os01g64070:12001.t05775:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6275 Score = 32.2 bits (64), Expect(2) = 1.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +2 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 2447 CFNCGEYGHFANKC 2488 Score = 25.4 bits (49), Expect(2) = 1.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 / +2 Query: 350 VCWQLGCPGDCWGT*R 397 +CW+L D WG+*R Sbjct: 437 LCWRLTTTRDVWGS*R 484
>LOC_Os09g08580:12009.t00652:unspliced-genomic expressed protein| Length = 1183 Score = 31.3 bits (62), Expect(2) = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 / +3 Query: 857 AIAATTGWGWRSTAASWRAITR 792 A AATTG WR A WR TR Sbjct: 900 ANAATTGG*WRGACACWRCSTR 965 Score = 24.0 bits (46), Expect(2) = 1.5 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 / +3 Query: 464 KRKTRWFTCNPYT 426 ++KT W T NPY+ Sbjct: 1116 QQKTAWSTANPYS 1154
>LOC_Os03g23840:12003.t02079:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6720 Score = 31.3 bits (62), Expect(2) = 1.5 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +1 / -1 Query: 208 VVELMLRGLPRSPHSRSGRWALLLFLLDRI*GFPITTALGICSPWPACML 357 ++ L+LR RSGRWA LL LL + G +G+ +P + +L Sbjct: 3141 LILLLLRLWDAHHELRSGRWARLLLLLLLLRGGSPWVGIGVANPLVSTLL 2992 Score = 26.3 bits (51), Expect(2) = 1.5 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 / -1 Query: 90 PTNGAPAPRRRSPLGFCVCFPHEDRKYLDVESSR 191 P+ G R P + FPHE +Y V SSR Sbjct: 3540 PSRGGDEQRVSKPFYPQLIFPHEWHRYKRVGSSR 3439
>LOC_Os06g32820:12006.t02979:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5911 Score = 30.9 bits (61), Expect(2) = 1.9 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 / -2 Query: 208 VVELMLRGLPRSPHSRSGRWALLLFLLDRI*GFPITTALGICSPWPACML 357 ++ L+LR RSGRWA LL LL + G +G+ P + +L Sbjct: 3144 LILLLLRLWDAHHELRSGRWARLLLLLLLLRGGSPWVGIGVADPLVSTLL 2995 Score = 26.3 bits (51), Expect(2) = 1.9 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 / -1 Query: 90 PTNGAPAPRRRSPLGFCVCFPHEDRKYLDVESSR 191 P+ G R P + FPHE +Y V SSR Sbjct: 3496 PSRGGDEQRVSKPFYPQLTFPHEWHRYKRVGSSR 3395
>LOC_Os11g22910:12011.t01961:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2409 Score = 34.1 bits (68), Expect = 1.9 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 / +1 Query: 633 CYECGESGHFARECRLRIGAG 695 CY CGE GHFA +C AG Sbjct: 64 CYNCGEHGHFADKCPKPCRAG 126
>LOC_Os10g32124:12010.t02532:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8216 Score = 34.1 bits (68), Expect = 1.9 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+E GE GHFA +C Sbjct: 820 SNLRCFEYGEKGHFASKC 873
>LOC_Os08g14290:12008.t01304:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3804 Score = 34.1 bits (68), Expect = 1.9 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGESGHFA +C Sbjct: 67 CFNCGESGHFADKC 108
>LOC_Os05g08694:12005.t00747:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8023 Score = 34.1 bits (68), Expect = 1.9 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFAREC 674 S+++C+E GE GHFA +C Sbjct: 618 SNLRCFEYGEKGHFASKC 671
>LOC_Os04g56460:12004.t05116:unspliced-genomic ATBPM1, putative, expressed| Length = 1062 Score = 34.1 bits (68), Expect = 1.9 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 / +2 Query: 890 RRIIPGTDW*LAIAATTGWGWRSTAASWRA 801 RR PGT W + AAT WRST+A+ R+ Sbjct: 572 RRATPGTPWSSSSAATPRSTWRSTSATRRS 661
>LOC_Os03g47800:12003.t04141:unspliced-genomic heterogeneous nuclear ribonucleoprotein A2 homolog 2, putative,| expressed Length = 4563 Score = 34.1 bits (68), Expect = 1.9 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +3 / +2 Query: 633 CYECGESGHFAREC 674 C+ECG +GH+AR+C Sbjct: 3374 CFECGRAGHWARDC 3415
>LOC_Os02g38000:12002.t03438:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 5180 Score = 34.1 bits (68), Expect = 1.9 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +3 / +1 Query: 624 DMKCYECGESGHFARECR 677 D C+ CG++GH+A++CR Sbjct: 1429 DNTCHNCGKTGHWAKDCR 1482
>LOC_Os02g34030:12002.t03044:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4272 Score = 34.1 bits (68), Expect = 1.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C E GH++++CR Sbjct: 883 SKVKCFNCDEYGHYSKQCR 939
>LOC_Os02g28550:12002.t02549:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3817 Score = 34.1 bits (68), Expect = 1.9 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGESGHFA +C Sbjct: 730 CFNCGESGHFADKC 771
>LOC_Os01g12950:12001.t01161:unspliced-genomic ubiquitin-conjugating enzyme, putative, expressed| Length = 17122 Score = 32.2 bits (64), Expect(2) = 1.9 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 / -1 Query: 388 NLKMSFVCLEFCEVYGLHVNHLVLRL 465 N +++CL +C++YG V H L+L Sbjct: 4828 NSWQNYICLNYCQIYGPKVEHSNLKL 4751 Score = 26.3 bits (51), Expect(2) = 1.9 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 / -1 Query: 90 PTNGAPAPRRRSPLG 134 P + +P+PRRRSP G Sbjct: 11695 PPHRSPSPRRRSPSG 11651
>LOC_Os06g05840:12006.t00470:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3302 Score = 28.6 bits (56), Expect(2) = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 / +1 Query: 836 WGWRSTAASWRAITR 792 W W+S ASWR I R Sbjct: 2368 WRWKSAPASWRGIWR 2412 Score = 27.6 bits (54), Expect(2) = 2.0 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = -2 / +1 Query: 387 PQQSPGHPSCQHTSGPW*TDPESSRYRKTSNPIQEKQQQRPTPRSGMWRS 238 P G + TS P S +T +P + +RP PR WR+ Sbjct: 2422 PPSPSGRQRWRRTSPPVPKRSPHSASARTRSPSGSELSRRPRPRRNGWRT 2571
>LOC_Os07g30350:12007.t02724:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3334 Score = 28.6 bits (56), Expect(2) = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 / +3 Query: 836 WGWRSTAASWRAITR 792 W W+S ASWR I R Sbjct: 2400 WRWKSAPASWRGIWR 2444 Score = 27.6 bits (54), Expect(2) = 2.0 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = -2 / +3 Query: 387 PQQSPGHPSCQHTSGPW*TDPESSRYRKTSNPIQEKQQQRPTPRSGMWRS 238 P G + TS P S +T +P + +RP PR WR+ Sbjct: 2454 PPSPSGRQRWRRTSPPVPKRSPHSASARTRSPSGSELSRRPRPRRNGWRT 2603
>LOC_Os03g56890:12003.t04954:unspliced-genomic expressed protein| Length = 767 Score = 31.3 bits (62), Expect(2) = 2.4 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 / -2 Query: 147 SRRKNRGGCADEGRELRS*G 88 SRR+ RGGCA GR R+ G Sbjct: 145 SRRRRRGGCAGHGRRRRAGG 86 Score = 22.6 bits (43), Expect(2) = 2.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -2 / -2 Query: 1002 SGLSTPSRQS*RVTSRREHASDTGFRSNSGC 910 +G + PSR+ R SRR + R GC Sbjct: 211 TGPAAPSRRRRRPWSRRRSPGRSRRRRRGGC 119
>LOC_Os10g35400:12010.t02835:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3116 Score = 28.6 bits (56), Expect(2) = 2.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 / +1 Query: 836 WGWRSTAASWRAITR 792 W W+S ASWR I R Sbjct: 2368 WRWKSAPASWRGIWR 2412 Score = 27.2 bits (53), Expect(2) = 2.6 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = -2 / +1 Query: 387 PQQSPGHPSCQHTSGPW*TDPESSRYRKTSNPIQEKQQQRPTPRSGMWRS 238 P G + TS P S +T +P + +RP PR WR+ Sbjct: 2422 PPSLSGRQHWRRTSPPVPKRSPHSASTRTRSPSGSELSRRPRPRRNGWRT 2571
>LOC_Os12g25220:12012.t02244:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2651 Score = 33.6 bits (67), Expect = 2.6 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 / +3 Query: 633 CYECGESGHFAREC 674 CY CGE GHFA +C Sbjct: 1992 CYNCGEHGHFADKC 2033
>LOC_Os11g36679:12011.t004406:unspliced-genomic conserved hypothetical protein| Length = 3680 Score = 33.6 bits (67), Expect = 2.6 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY+CGE G+FAR C Sbjct: 2548 CYKCGEEGYFARGC 2589
>LOC_Os07g25360:12007.t02232:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 3951 Score = 33.6 bits (67), Expect = 2.6 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +3 / +2 Query: 630 KCYECGESGHFARECR 677 KC+ CG+ GH+A++CR Sbjct: 218 KCHNCGKLGHWAKDCR 265
>LOC_Os05g11110:12005.t00943:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4317 Score = 33.6 bits (67), Expect = 2.6 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFARECR 677 S ++C+ C GH+A+ECR Sbjct: 900 SSVRCFNCDNYGHYAKECR 956
>LOC_Os05g08870:12005.t00764:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 3901 Score = 33.6 bits (67), Expect = 2.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 / +1 Query: 633 CYECGESGHFARECRLRIG 689 C+ CG+ GH AR+C R+G Sbjct: 724 CFVCGQPGHLARKCLQRMG 780
>LOC_Os05g06280:12005.t00518:unspliced-genomic ATP binding protein, putative, expressed| Length = 11075 Score = 33.6 bits (67), Expect = 2.6 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = +3 / +1 Query: 348 LYVGNLDARVTAGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG 518 L+V NL T L+ F + + V + PG AF+++ D+ A A+ L G Sbjct: 10570 LFVQNLPHETTPMMLQMLFCQYPGFKEVRMVEAKPGIAFVEYGDEGQATAAMNHLQG 10740
>LOC_Os03g57260:12003.t04993:unspliced-genomic GRF zinc finger family protein, expressed| Length = 4553 Score = 33.6 bits (67), Expect = 2.6 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 / +3 Query: 633 CYECGESGHFARECRLRIGAGG 698 C++CG+S H+AREC + A G Sbjct: 402 CFKCGDSCHWARECPQSVPATG 467 Score = 32.7 bits (65), Expect = 4.9 Identities = 8/14 (57%), Positives = 14/14 (100%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C++CG+SGH++R+C Sbjct: 4177 CFKCGKSGHWSRDC 4218
>LOC_Os03g36290:12003.t03100:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5204 Score = 33.6 bits (67), Expect = 2.6 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 / +3 Query: 624 DMKCYECGESGHFARECRLRIGAGG 698 D CY C + GHFAR C R GG Sbjct: 2160 DSPCYVCVKVGHFARLCPNRQNTGG 2234
>LOC_Os03g25770:12003.t02273:unspliced-genomic splicing factor, arginine/serine-rich 2, putative, expressed| Length = 3540 Score = 33.6 bits (67), Expect = 2.6 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 / +1 Query: 441 RKPPGFAFIDFDDKRDAEDALRDLDGK 521 R+P GF FI + D DA DA +DG+ Sbjct: 2458 REPRGFGFIQYYDPEDAADAKYHMDGQ 2538
>LOC_Os02g03040:12002.t00204:unspliced-genomic arginine/serine-rich splicing factor RSP41, putative, expressed| Length = 3690 Score = 33.6 bits (67), Expect = 2.6 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 / +2 Query: 420 LRSVWVARKPPGFAFIDFDDKRDAEDALRDLD 515 L S ++ GFAF+ +D+RDA++A+ LD Sbjct: 2282 LTSYFIMFNMAGFAFVYMEDERDADEAIHRLD 2377
>LOC_Os01g32630:12001.t02836:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5443 Score = 33.6 bits (67), Expect = 2.6 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 / +2 Query: 621 SDMKCYECGESGHFARECR 677 S +KC+ C + GH+++ECR Sbjct: 2057 SKVKCFNCDKLGHYSKECR 2113
>LOC_Os04g21680:12004.t01899:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3273 Score = 28.6 bits (56), Expect(2) = 2.7 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = -2 / +2 Query: 387 PQQSPGHPSCQHTSGPW*TDPESSRYRKTSNPIQEKQQQRPTPRSGMWRS 238 P PG + TS P S +T P + +RP PR WR+ Sbjct: 2393 PPSPPGRQRWRRTSLPAPKRSPHSASARTRLPSGSELSKRPRPRRNGWRT 2542 Score = 27.2 bits (53), Expect(2) = 2.7 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 / +2 Query: 836 WGWRSTAASWRAITR 792 W WRS ASWR R Sbjct: 2339 WRWRSAPASWRRTWR 2383
>LOC_Os01g36170:12001.t03167:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6676 Score = 30.4 bits (60), Expect(2) = 2.8 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 / -1 Query: 208 VVELMLRGLPRSPHSRSGRWALLLFLLDRI*GFPITTALGICSPWPACML 357 ++ L+LR RSGRWA LL LL + G +G+ P + +L Sbjct: 3097 LILLLLRLWDAHHELRSGRWARLLLLLLLLRGGSPWIGIGVADPLVSTLL 2948 Score = 26.3 bits (51), Expect(2) = 2.8 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 / -1 Query: 90 PTNGAPAPRRRSPLGFCVCFPHEDRKYLDVESSR 191 P+ G R P + FPHE +Y V SSR Sbjct: 3496 PSRGGDEQRVSKPFYPQLIFPHEWHRYKRVGSSR 3395
>LOC_Os04g10100:12004.t00843:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6726 Score = 30.4 bits (60), Expect(2) = 2.8 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 / -1 Query: 208 VVELMLRGLPRSPHSRSGRWALLLFLLDRI*GFPITTALGICSPWPACML 357 ++ L+LR RSGRWA LL LL + G +G+ P + +L Sbjct: 3147 LILLLLRLWDAHHELRSGRWARLLLLLLLLRGGSPWIGIGVADPLVSTLL 2998 Score = 26.3 bits (51), Expect(2) = 2.8 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 / -1 Query: 90 PTNGAPAPRRRSPLGFCVCFPHEDRKYLDVESSR 191 P+ G R P + FPHE +Y V SSR Sbjct: 3546 PSRGGDEQRVSKPFYPQLIFPHEWHRYKRVGSSR 3445
>LOC_Os11g38820:12011.t03425:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5614 Score = 30.9 bits (61), Expect(2) = 3.2 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 / +2 Query: 624 DMKCYECGESGHFAREC 674 ++ C+ CGE GH+A C Sbjct: 2432 NVDCFNCGEYGHYANNC 2482 Score = 25.4 bits (49), Expect(2) = 3.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 / +2 Query: 350 VCWQLGCPGDCWGT*R 397 +CW+L D WG+*R Sbjct: 437 LCWRLTTTRDVWGS*R 484
>LOC_Os07g15080:12007.t01371:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5990 Score = 30.9 bits (61), Expect(2) = 3.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 / +3 Query: 624 DMKCYECGESGHFAREC 674 ++ C+ CGE GH+A C Sbjct: 2439 NVDCFNCGEYGHYANNC 2489 Score = 25.4 bits (49), Expect(2) = 3.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 / +2 Query: 350 VCWQLGCPGDCWGT*R 397 +CW+L D WG+*R Sbjct: 437 LCWRLTTTRDVWGS*R 484
>LOC_Os04g13880:12004.t01208:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2223 Score = 30.4 bits (60), Expect(2) = 3.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 / +1 Query: 633 CYECGESGHFAR 668 CY+CGE GH+ R Sbjct: 856 CYDCGEQGHYVR 891 Score = 24.4 bits (47), Expect(2) = 3.5 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 / +1 Query: 895 LKGIAAAGVRSEACVRCMFSARSYSLALP 981 L G+ +AC RC + SL LP Sbjct: 1273 LNSFMERGLEFKACTRCGIVGHTASLCLP 1359
>LOC_Os12g05310:12012.t00419:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 16627 Score = 33.1 bits (66), Expect = 3.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 / +1 Query: 630 KCYECGESGHFARECR 677 +C+ CGE GH R+CR Sbjct: 9016 ECFNCGEMGHLMRDCR 9063
>LOC_Os11g34490:12011.t03002:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3708 Score = 33.1 bits (66), Expect = 3.6 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S ++C+ C + GH+AREC Sbjct: 157 SAVQCFRCNQMGHYAREC 210
>LOC_Os11g32720:12011.t02868:unspliced-genomic zinc knuckle family protein, expressed| Length = 4457 Score = 33.1 bits (66), Expect = 3.6 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY CGE GH++R C Sbjct: 3805 CYRCGEDGHWSRNC 3846
>LOC_Os08g29560:12008.t02711:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 5390 Score = 33.1 bits (66), Expect = 3.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 / +2 Query: 630 KCYECGESGHFARECR 677 +C+ CGE GH R+CR Sbjct: 1625 ECFNCGEMGHLMRDCR 1672
>LOC_Os07g41380:12007.t03793:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4414 Score = 33.1 bits (66), Expect = 3.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 / +2 Query: 630 KCYECGESGHFARECR 677 +C+ CGE GH R+CR Sbjct: 800 ECFNCGEMGHLMRDCR 847
>LOC_Os05g17830:12005.t01552:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6191 Score = 33.1 bits (66), Expect = 3.6 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S ++C++CG GH AREC Sbjct: 1150 SGIQCFKCGGRGHVAREC 1203
>LOC_Os05g16390:12005.t01409:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5742 Score = 33.1 bits (66), Expect = 3.6 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +3 / +2 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA++C Sbjct: 2240 CFNCGELGHFAKKC 2281
>LOC_Os04g45440:12004.t04078:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 8760 Score = 33.1 bits (66), Expect = 3.6 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S ++C+ C ++GH+AR+C Sbjct: 5209 STVQCFRCNQTGHYARQC 5262
>LOC_Os03g30810:12003.t02687:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4236 Score = 33.1 bits (66), Expect = 3.6 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 / +3 Query: 624 DMKCYECGESGHFARECR 677 D KC CG+ GH+A++CR Sbjct: 864 DDKCRSCGKLGHWAKDCR 917
>LOC_Os02g15310:12002.t01324:unspliced-genomic SR repressor protein, putative, expressed| Length = 4307 Score = 33.1 bits (66), Expect = 3.6 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 / +3 Query: 429 VWVARKPPGFAFIDFDDKRDAEDA 500 +++ R+P GFAF++F D DA +A Sbjct: 2523 IYIYREPRGFAFVEFVDPYDASEA 2594
>LOC_Os02g06230:12002.t00521:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4422 Score = 33.1 bits (66), Expect = 3.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 / +1 Query: 630 KCYECGESGHFARECR 677 +C+ CGE GH R+CR Sbjct: 796 ECFNCGEMGHLMRDCR 843
>LOC_Os01g31810:12001.t02762:unspliced-genomic expressed protein| Length = 4726 Score = 33.1 bits (66), Expect = 3.6 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +3 / +1 Query: 444 KPPGFAFIDFDDKRDAEDALRDLDGK 521 +P GF F+ + + DAE A++ +DG+ Sbjct: 3277 RPKGFGFVKYSSQADAEKAVKAMDGR 3354
>LOC_Os01g06680:12001.t00551:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 5123 Score = 33.1 bits (66), Expect = 3.6 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 / +2 Query: 621 SDMKCYECGESGHFAREC 674 S ++C+ CG+ GHFA EC Sbjct: 4520 SKIECHRCGKFGHFADEC 4573
>LOC_Os02g04900:12002.t00388:unspliced-genomic hypothetical protein| Length = 1278 Score = 27.6 bits (54), Expect(2) = 3.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 / -2 Query: 452 RWFTCNPYTSQNS 414 RW TC+ YTS NS Sbjct: 1061 RWMTCDEYTSVNS 1023 Score = 22.6 bits (43), Expect(2) = 3.7 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 / -2 Query: 348 SGPW*TDPESSRYRKTSNPIQEKQQQRP 265 SG W + + S +T + E+ QRP Sbjct: 929 SGCWTVEEDRSHAPRTPSSAAERPNQRP 846
>LOC_Os09g04550:12009.t00351:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4736 Score = 28.1 bits (55), Expect(2) = 3.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 / +2 Query: 923 DLKPVSDACSLREVTL*LCLLGVLRPDVNFLTSV 1024 D +P++D R + L LGV RPD+++ + Sbjct: 3566 DGEPLADPTRYRHIVGSLVYLGVTRPDISYAVHI 3667 Score = 27.6 bits (54), Expect(2) = 3.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 / +1 Query: 272 CCCFSWIGFEVFL* 313 CCC+SW F FL* Sbjct: 1270 CCCWSWDSFYFFL* 1311
>LOC_Os11g33454:12011.t02940:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1236 Score = 29.0 bits (57), Expect(2) = 3.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CG+ GH+A +C Sbjct: 937 CFNCGDPGHYADKC 978 Score = 24.9 bits (48), Expect(2) = 3.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 / +1 Query: 931 ACVRCMFSARSYSLALPARS 990 AC RC +SA + + + PARS Sbjct: 1114 ACHRCTWSAAAAAASPPARS 1173
>LOC_Os05g19140:12005.t01680:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6723 Score = 29.9 bits (59), Expect(2) = 3.7 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +1 / -1 Query: 217 LMLRGLPRSPHSRSGRWALLLFLLDRI*GFPITTALGICSPWPACML 357 L+LR RSGRWA LL LL + G +G+ P + +L Sbjct: 3138 LLLRLWDAHHELRSGRWARLLLLLLLLRGGSPWIGIGVADPLVSTLL 2998 Score = 26.3 bits (51), Expect(2) = 3.7 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 / -1 Query: 90 PTNGAPAPRRRSPLGFCVCFPHEDRKYLDVESSR 191 P+ G R P + FPHE +Y V SSR Sbjct: 3543 PSRGGDEQRVSKPFYPQLIFPHEWHRYKRVGSSR 3442
>LOC_Os11g31910:12011.t02788:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 3513 Score = 28.6 bits (56), Expect(2) = 3.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 / +2 Query: 836 WGWRSTAASWRAITR 792 W W+S ASWR I R Sbjct: 2579 WRWKSAPASWRGIWR 2623 Score = 26.7 bits (52), Expect(2) = 3.8 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = -2 / +2 Query: 387 PQQSPGHPSCQHTSGPW*TDPESSRYRKTSNPIQEKQQQRPTPRSGMWRS 238 P G + TS P S +T +P + +RP PR WR+ Sbjct: 2633 PPSLSGRQRWRRTSLPVPKRSPHSASERTHSPSGSELSRRPRPRRNGWRT 2782
>LOC_Os07g47630:12007.t04397:unspliced-genomic pre-mRNA-splicing factor SF2, putative, expressed| Length = 5111 Score = 31.8 bits (63), Expect(2) = 3.9 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 / +2 Query: 471 FDDKRDAEDALRDLDGKN 524 F+D RDAEDA+R DG N Sbjct: 1085 FEDPRDAEDAIRGRDGYN 1138 Score = 24.0 bits (46), Expect(2) = 3.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 / +3 Query: 348 LYVGNLDARVTAGELEDEFRVFG 416 +YVGNL + E+ED F G Sbjct: 519 IYVGNLPGDIREREVEDLFYKVG 587
>LOC_Os02g53330:12002.t04912:unspliced-genomic 1-aminocyclopropane-1-carboxylate deaminase, putative, expressed| Length = 5153 Score = 26.3 bits (51), Expect(2) = 4.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 / +1 Query: 266 GRCCCFSWIGFEVFL 310 GR C + WI FEV L Sbjct: 319 GRTCSYRWIRFEVVL 363 Score = 23.5 bits (45), Expect(2) = 4.5 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 / +2 Query: 90 PTNGAPAPRRRSPLGFCVCFP 152 P P PRR S VCFP Sbjct: 227 PRTCPPPPRRPSRSAM*VCFP 289
>LOC_Os02g03890:12002.t00288:unspliced-genomic RNA binding protein, putative, expressed| Length = 3049 Score = 32.2 bits (64), Expect(2) = 4.5 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 / +1 Query: 348 LYVGNLDARVTAGELEDEFRVFGVL 422 +YVGN+ + V+ +LE+EF+ FG L Sbjct: 1897 VYVGNVPSSVSEADLENEFKKFGRL 1971 Score = 22.6 bits (43), Expect(2) = 4.5 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 272 CCCFSWIGFEVFL 310 CC F+W+ +FL Sbjct: 1524 CCTFTWLIMIIFL 1562
>LOC_Os12g36880:12012.t03368:unspliced-genomic major pollen allergen Bet v 1-D/H, putative, expressed| Length = 1307 Score = 32.7 bits (65), Expect = 4.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 / -1 Query: 90 PTNGAPAPRRRSPLGFCVCFPH 155 PT G RR P G C+CFPH Sbjct: 764 PTLGHDLRRRTPPPGSCMCFPH 699
>LOC_Os12g15060:12012.t01363:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 7956 Score = 32.7 bits (65), Expect = 4.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 / -3 Query: 633 CYECGESGHFAREC 674 C+ C E GHFAREC Sbjct: 1306 CFNCYEPGHFAREC 1265
>LOC_Os11g21830:12011.t01853:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5463 Score = 32.7 bits (65), Expect = 4.9 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 / +1 Query: 624 DMKCYECGESGHFAREC 674 +M C+ CGE GH+A C Sbjct: 2200 NMDCFNCGEYGHYANNC 2250
>LOC_Os10g25990:12010.t02014:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 1187 Score = 32.7 bits (65), Expect = 4.9 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 / +1 Query: 630 KCYECGESGHFAREC 674 KC++CG GH AR+C Sbjct: 820 KCFDCGVRGHMARDC 864
>LOC_Os09g09600:12009.t00752:unspliced-genomic hypothetical protein| Length = 3136 Score = 32.7 bits (65), Expect = 4.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 / +3 Query: 633 CYECGESGHFAREC 674 CY CGE GH AR+C Sbjct: 99 CYMCGEEGHKARDC 140
>LOC_Os09g08370:12009.t00631:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 7757 Score = 32.7 bits (65), Expect = 4.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 / +3 Query: 633 CYECGESGHFARECRLR 683 C+ C E GHFA C LR Sbjct: 4623 CFSCNEMGHFANRCPLR 4673
>LOC_Os08g44830:12008.t04206:unspliced-genomic zinc finger protein, putative, expressed| Length = 4153 Score = 32.7 bits (65), Expect = 4.9 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 / +1 Query: 854 IAATTGWGWRSTAASWRAITRAVTSS 777 +AA+T W WR AASW + A S Sbjct: 2752 VAASTAWRWRRAAASWASSHSATRCS 2829
>LOC_Os08g26500:12008.t02416:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5184 Score = 32.7 bits (65), Expect = 4.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +3 / +2 Query: 630 KCYECGESGHFARECR 677 KC CGE GH+A++CR Sbjct: 3461 KCRYCGELGHWAKDCR 3508
>LOC_Os07g18730:12007.t01731:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3542 Score = 32.7 bits (65), Expect = 4.9 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 / +1 Query: 630 KCYECGESGHFARECR 677 KC CG +GH+A++CR Sbjct: 904 KCRNCGRTGHWAKDCR 951
>LOC_Os07g15260:12007.t01389:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 3849 Score = 32.7 bits (65), Expect = 4.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 / +1 Query: 624 DMKCYECGESGHFARECRLRIG 689 +M C+ CG+ GH R+C R G Sbjct: 712 EMTCFVCGQPGHLVRKCPQRKG 777
>LOC_Os06g32770:12006.t02974:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2318 Score = 32.7 bits (65), Expect = 4.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ C E GH+AREC Sbjct: 304 CFRCDEQGHYAREC 345
>LOC_Os06g28330:12006.t02537:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4365 Score = 32.7 bits (65), Expect = 4.9 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 / +1 Query: 630 KCYECGESGHFARECR 677 KC CG +GH+A++CR Sbjct: 904 KCRNCGRTGHWAKDCR 951
>LOC_Os06g27540:12006.t02459:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4997 Score = 32.7 bits (65), Expect = 4.9 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 / +1 Query: 624 DMKCYECGESGHFAREC 674 D++C++CG GH REC Sbjct: 940 DIQCFKCGGRGHVVREC 990
>LOC_Os05g24310:12005.t02088:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3480 Score = 32.7 bits (65), Expect = 4.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 67 CFNCGEHGHFANKC 108
>LOC_Os05g02400:12005.t00139:unspliced-genomic RNA binding protein, putative, expressed| Length = 2853 Score = 32.7 bits (65), Expect = 4.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CYECG +GH A EC Sbjct: 2794 CYECGIAGHLASEC 2835 Score = 31.8 bits (63), Expect = 9.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 / +1 Query: 630 KCYECGESGHFARECRLRIGA 692 KCYECG GH + C ++ A Sbjct: 2608 KCYECGIPGHLSSACPNKVAA 2670
>LOC_Os04g49290:12004.t04445:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4364 Score = 32.7 bits (65), Expect = 4.9 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 / +1 Query: 630 KCYECGESGHFARECR 677 KC CG +GH+A++CR Sbjct: 904 KCRNCGRTGHWAKDCR 951
>LOC_Os04g17190:12004.t01471:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 3231 Score = 32.7 bits (65), Expect = 4.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 / +1 Query: 627 MKCYECGESGHFARECRLRIGAGG 698 M+C C + GH ++ C + GAGG Sbjct: 2650 MRCRSCKQPGHNSKGCHMHSGAGG 2721
>LOC_Os04g16270:12004.t01387:unspliced-genomic zinc knuckle family protein| Length = 1599 Score = 32.7 bits (65), Expect = 4.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 / +1 Query: 627 MKCYECGESGHFARECRLRIG 689 +KC++C E GHFA + L IG Sbjct: 1534 IKCFKCTEVGHFASKVSLHIG 1596
>LOC_Os03g58060:12003.t05067:unspliced-genomic XRN4, putative, expressed| Length = 11089 Score = 32.7 bits (65), Expect = 4.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 / +2 Query: 630 KCYECGESGHFARECR 677 KC+ CG+ GH A ECR Sbjct: 1646 KCFLCGQVGHLAAECR 1693
>LOC_Os03g07920:12003.t00652:unspliced-genomic expressed protein| Length = 1527 Score = 32.7 bits (65), Expect = 4.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 / +2 Query: 845 TTGWGWRSTAASWRAITRAVTSS 777 ++GW WR+T + RA TRA T S Sbjct: 854 SSGWRWRATRTTTRAATRAPTCS 922
>LOC_Os02g29690:12002.t02662:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 615 Score = 32.7 bits (65), Expect = 4.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ C E GHFAREC Sbjct: 451 CFNCYEPGHFAREC 492
>LOC_Os02g27180:12002.t02412:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 748 Score = 32.7 bits (65), Expect = 4.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 / +3 Query: 851 AATTGWGWRSTAASWRAI 798 AA GWGWR AA WR + Sbjct: 282 AA*GGWGWRQEAAGWRQL 335
>LOC_Os09g13710:12009.t01160:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5559 Score = 32.7 bits (65), Expect = 4.9 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +1 / -1 Query: 208 VVELMLRGLPRSPHSRSGRWALLLFLLDRI*GFPITTALGICSPWPACMLAT 363 ++ L+LR RSGRWA LL LL + G +G+ P + +L T Sbjct: 1980 LILLLLRLWDAHHELRSGRWARLLLLLLLLRGGSPWVGIGVADPLVSTLLIT 1825
>LOC_Os08g18090:12008.t01679:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3363 Score = 32.7 bits (65), Expect = 4.9 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -2 / +2 Query: 387 PQQSPGHPSCQHTSGPW*TDPESSRYRKTSNPIQEKQQQRPTPRSGMWRS 238 P PG + TS P S + KT +P + +RP P+ WR+ Sbjct: 2483 PPSPPGRQRWRRTSLPAPKRSPHSAFAKTRSPSGSELSKRPRPKRNGWRT 2632
>LOC_Os08g16990:12008.t01570:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 4062 Score = 32.7 bits (65), Expect = 4.9 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -2 / -2 Query: 417 LQTHETHLQVPQQSPGHPSCQHTSGP 340 L T E+H VP Q+ PSC H + P Sbjct: 656 LPTSESHEHVPLQNDHRPSCSHRTAP 579
>LOC_Os01g62990:12001.t05670:unspliced-genomic pollen-specific kinase partner protein, putative, expressed| Length = 4133 Score = 29.5 bits (58), Expect(2) = 5.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 / +1 Query: 776 QKKLQPS*SLSKTPQCFSSPSPWS 847 QK+ PS T QC S SPWS Sbjct: 196 QKRRAPSSGTGTTEQCARSSSPWS 267 Score = 25.4 bits (49), Expect(2) = 5.9 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 / +2 Query: 87 PPTNGAPAPRRRSP 128 PPT APAP R P Sbjct: 56 PPTGAAPAPTRPRP 97
>LOC_Os01g64610:12001.t05828:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3302 Score = 28.6 bits (56), Expect(2) = 6.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 / +1 Query: 836 WGWRSTAASWRAITR 792 W W+S ASWR I R Sbjct: 2368 WRWKSAPASWRGIWR 2412 Score = 25.8 bits (50), Expect(2) = 6.6 Identities = 13/50 (26%), Positives = 19/50 (38%) Frame = -2 / +1 Query: 387 PQQSPGHPSCQHTSGPW*TDPESSRYRKTSNPIQEKQQQRPTPRSGMWRS 238 P G + T P S + +T +P + + P PR WRS Sbjct: 2422 PPSPSGKQRWRRTRLPAPKKSSRSAFARTRSPNGSELSRGPRPRRNSWRS 2571
>LOC_Os10g42066:12010.t03435:unspliced-genomic hypothetical protein| Length = 1475 Score = 26.7 bits (52), Expect(2) = 6.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 / +1 Query: 836 WGWRSTAASWRAITRAVTS 780 W WR+ SWR + TS Sbjct: 1333 WSWRTKTCSWRPCFMSTTS 1389 Score = 22.6 bits (43), Expect(2) = 6.6 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 / +1 Query: 957 RREHASDTGFRSNSGC 910 RR H TG R+ S C Sbjct: 1222 RRRHLRQTGRRATSSC 1269
>LOC_Os12g35150:12012.t03203:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1266 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1099 CYNCKEPGHFSRDC 1140
>LOC_Os12g33980:12012.t03087:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1266 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1099 CYNCKEPGHFSRDC 1140
>LOC_Os12g32060:12012.t02909:unspliced-genomic hypothetical protein| Length = 780 Score = 32.2 bits (64), Expect = 6.8 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -3 / -2 Query: 860 LAIAATTGWGWRSTAASWRAITRAVTSS 777 L + ATT W ++ ASWR++ R +T++ Sbjct: 434 LVLCATTSWTLLASRASWRSLMRLLTAT 351
>LOC_Os12g30890:12012.t02795:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1350 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1183 CYNCKEPGHFSRDC 1224
>LOC_Os12g30240:12012.t02730:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2806 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +2 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 2639 CYNCKEPGHFSRDC 2680
>LOC_Os12g29850:12012.t02695:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5923 Score = 32.2 bits (64), Expect = 6.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 / -2 Query: 633 CYECGESGHFAREC 674 CY C E GH++R+C Sbjct: 4269 CYNCSEEGHYSRDC 4228
>LOC_Os12g28380:12012.t02548:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1350 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1183 CYNCKEPGHFSRDC 1224
>LOC_Os12g26790:12012.t02392:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4413 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 871 CFNCGEYGHFANKC 912
>LOC_Os12g23060:12012.t02040:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3657 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 115 CFNCGEYGHFANKC 156
>LOC_Os12g21580:12012.t01900:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1988 Score = 32.2 bits (64), Expect = 6.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 / +3 Query: 633 CYECGESGHFARECRLRIGAG 695 C+ CGE GHFA +C AG Sbjct: 1047 CFNCGEHGHFADKCPKPTRAG 1109
>LOC_Os12g12910:12012.t01159:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 816 Score = 32.2 bits (64), Expect = 6.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFAREC 674 S + CY C E GHFA EC Sbjct: 688 SKVMCYHCQELGHFAFEC 741
>LOC_Os12g10110:12012.t00888:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 987 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECRLR 683 +++ C+ CGE GH+A +C R Sbjct: 226 TNVTCFGCGEKGHYANKCPQR 288
>LOC_Os11g43100:12011.t03840:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1350 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1183 CYNCKEPGHFSRDC 1224
>LOC_Os11g43090:12011.t03839:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1350 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1183 CYNCKEPGHFSRDC 1224
>LOC_Os11g33466:12011.t02943:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1218 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1051 CYNCKEPGHFSRDC 1092
>LOC_Os11g30860:12011.t02686:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3012 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +3 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 870 CFNCGEYGHFANKC 911
>LOC_Os11g27050:12011.t02320:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4917 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 871 CFNCGEYGHFANKC 912
>LOC_Os11g03250:12011.t00216:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4040 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 871 CFNCGEYGHFANKC 912
>LOC_Os10g39820:12010.t03225:unspliced-genomic DNA-binding protein HEXBP, putative, expressed| Length = 3849 Score = 32.2 bits (64), Expect = 6.8 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 / +3 Query: 633 CYECGESGHFAREC 674 C CG+SGH AREC Sbjct: 2988 CRNCGKSGHIAREC 3029
>LOC_Os10g28930:12010.t02242:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4413 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 871 CFNCGEYGHFANKC 912
>LOC_Os10g28910:12010.t02239:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2021 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +3 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1854 CYNCKEPGHFSRDC 1895
>LOC_Os10g24160:12010.t01841:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2975 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1051 CYNCKEPGHFSRDC 1092
>LOC_Os10g12816:12010.t01060:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1218 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1051 CYNCKEPGHFSRDC 1092
>LOC_Os10g10660:12010.t00872:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2808 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 2641 CYNCKEPGHFSRDC 2682
>LOC_Os09g37850:12009.t03259:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1331 Score = 32.2 bits (64), Expect = 6.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 / +3 Query: 621 SDMKCYECGESGHFAREC 674 S + CY C E GHFA EC Sbjct: 1203 SKVMCYHCQELGHFAFEC 1256
>LOC_Os09g17250:12009.t01512:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2892 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 2725 CYNCKEPGHFSRDC 2766
>LOC_Os09g14310:12009.t01220:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1350 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1183 CYNCKEPGHFSRDC 1224
>LOC_Os09g08750:12009.t00669:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4899 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 871 CFNCGEYGHFANKC 912
>LOC_Os08g39540:12008.t03686:unspliced-genomic zinc knuckle family protein| Length = 525 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 / +1 Query: 621 SDMKCYECGESGHFARECRLR 683 +++ C+ CGE GH+A +C R Sbjct: 226 ANVTCFGCGEKGHYANKCPQR 288
>LOC_Os08g38940:12008.t03628:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4543 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +2 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 2408 CFNCGEYGHFANKC 2449
>LOC_Os08g28328:12008.t02590:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2507 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1183 CYNCKEPGHFSRDC 1224
>LOC_Os08g28319:12008.t02589:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2507 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1183 CYNCKEPGHFSRDC 1224
>LOC_Os08g24970:12008.t02267:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3563 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1183 CYNCKEPGHFSRDC 1224
>LOC_Os08g22740:12008.t02047:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3682 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 2221 CYNCKEPGHFSRDC 2262
>LOC_Os08g21030:12008.t01906:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1266 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1099 CYNCKEPGHFSRDC 1140
>LOC_Os08g11280:12008.t01010:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2810 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +3 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 2643 CYNCKEPGHFSRDC 2684
>LOC_Os07g45820:12007.t04219:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1350 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1183 CYNCKEPGHFSRDC 1224
>LOC_Os07g34480:12007.t03124:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2813 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +3 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 2646 CYNCKEPGHFSRDC 2687
>LOC_Os07g30430:12007.t02731:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3942 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 871 CFNCGEYGHFANKC 912
>LOC_Os07g26220:12007.t02318:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4404 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 871 CFNCGEYGHFANKC 912
>LOC_Os07g24250:12007.t02122:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1754 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +3 Query: 633 CYECGESGHFAREC 674 CY C E GHF+R+C Sbjct: 1587 CYNCKEPGHFSRDC 1628
>LOC_Os07g22090:12007.t01913:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3944 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 895 CFNCGELGHFANKC 936
>LOC_Os07g20330:12007.t01838:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass, expressed| Length = 4413 Score = 32.2 bits (64), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 633 CYECGESGHFAREC 674 C+ CGE GHFA +C Sbjct: 871 CFNCGEYGHFANKC 912 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 368,799,638 Number of extensions: 5758100 Number of successful extensions: 31747 Number of sequences better than 10.0: 479 Length of query: 372 Length of database: 55,613,886 Length adjustment: 50 Effective length of query: 322 Effective length of database: 52,799,986 Effective search space: 17001595492 Effective search space used: 17001595492 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
