ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf150c10 |
|---|---|
| Clone Library Name | barley_pub |
>Q28GR1:CCD72_XENTR Coiled-coil domain-containing protein 72 - Xenopus tropicalis| (Western clawed frog) (Silurana tropicalis) Length = 64 Score = 37.4 bits (85), Expect = 0.032 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = +1 Query: 106 KQGGKAKPLKQAKVAEKDYDENDLAYLQ 189 ++GGK KPLKQ K + KD DE+++A+ Q Sbjct: 4 REGGKKKPLKQPKKSNKDMDEDEIAFKQ 31
>Q20588:CCD72_CAEEL Coiled-coil domain-containing protein 72 homolog - Caenorhabditis| elegans Length = 64 Score = 37.0 bits (84), Expect = 0.042 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +1 Query: 106 KQGGKAKPLKQAKVAEKDYDENDLAY 183 +QGGKAKPLK AK EKD E D+ + Sbjct: 4 RQGGKAKPLKAAKKTEKDLSEEDVEF 29
>Q3E764:TMA7_YEAST Translation machinery-associated protein 7 - Saccharomyces| cerevisiae (Baker's yeast) Length = 64 Score = 36.2 bits (82), Expect = 0.071 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +1 Query: 103 SKQGGKAKPLKQAKVAEKDYDENDLAY 183 S+QGGK KPLKQ K ++D D D+A+ Sbjct: 3 SRQGGKMKPLKQKKKQQQDLDPEDIAF 29
>Q9XZS3:CCD72_DROME Coiled-coil domain-containing protein 72 homolog - Drosophila| melanogaster (Fruit fly) Length = 64 Score = 35.4 bits (80), Expect = 0.12 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 106 KQGGKAKPLKQAKVAEKDYDENDLAYLQ 189 ++GGK KPLK K KD DE+D+A+ Q Sbjct: 4 REGGKKKPLKAPKKDSKDLDEDDMAFKQ 31
>Q60QR6:CCD72_CAEBR Coiled-coil domain-containing protein 72 homolog - Caenorhabditis| briggsae Length = 64 Score = 35.0 bits (79), Expect = 0.16 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +1 Query: 106 KQGGKAKPLKQAKVAEKDYDENDLAY 183 +QGGKAKPLK K EKD E D+ + Sbjct: 4 RQGGKAKPLKAPKKGEKDLSEEDVEF 29
>Q1HRV4:CCD72_AEDAE Coiled-coil domain-containing protein 72 homolog - Aedes aegypti| (Yellowfever mosquito) Length = 64 Score = 35.0 bits (79), Expect = 0.16 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 106 KQGGKAKPLKQAKVAEKDYDENDLAYLQ 189 ++GGK KPLKQ K K+ DE D+A+ Q Sbjct: 4 REGGKKKPLKQPKKDGKEMDEEDMAFKQ 31
>Q4SUE2:CCD72_TETNG Coiled-coil domain-containing protein 72 - Tetraodon nigroviridis| (Green puffer) Length = 64 Score = 34.3 bits (77), Expect = 0.27 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +1 Query: 106 KQGGKAKPLKQAKVAEKDYDENDLAYLQ 189 ++GGK KPLK K KD D++D+A+ Q Sbjct: 4 REGGKKKPLKAPKKQSKDMDDDDVAFKQ 31
>Q8K003:CCD72_MOUSE Coiled-coil domain-containing protein 72 - Mus musculus (Mouse)| Length = 64 Score = 34.3 bits (77), Expect = 0.27 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 106 KQGGKAKPLKQAKVAEKDYDENDLAYLQ 189 ++GGK KPLKQ K K+ DE D A+ Q Sbjct: 4 REGGKKKPLKQPKKQAKEMDEEDKAFKQ 31
>Q9Y2S6:CCD72_HUMAN Coiled-coil domain-containing protein 72 - Homo sapiens (Human)| Length = 64 Score = 34.3 bits (77), Expect = 0.27 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 106 KQGGKAKPLKQAKVAEKDYDENDLAYLQ 189 ++GGK KPLKQ K K+ DE D A+ Q Sbjct: 4 REGGKKKPLKQPKKQAKEMDEEDKAFKQ 31
>A1A4Q4:CCD72_BOVIN Coiled-coil domain-containing protein 72 - Bos taurus (Bovine)| Length = 64 Score = 34.3 bits (77), Expect = 0.27 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 106 KQGGKAKPLKQAKVAEKDYDENDLAYLQ 189 ++GGK KPLKQ K K+ DE D A+ Q Sbjct: 4 REGGKKKPLKQPKKQAKEMDEEDKAFKQ 31
>Q9VG98:GSTT2_DROME Glutathione S-transferase D2 - Drosophila melanogaster (Fruit fly)| Length = 215 Score = 33.1 bits (74), Expect = 0.60 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 5/58 (8%) Frame = -1 Query: 403 MLNTTEGSLLQPQIVKRDTDR*IDRLSFSGHYEWAGR-----LISSHSSSDQILPAHP 245 +LNT EG L+P+ VK + I L +G W R L+ + D +LP P Sbjct: 30 LLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDYLLPNDP 87
>Q05AK9:CCD72_DANRE Coiled-coil domain-containing protein 72 - Danio rerio (Zebrafish)| (Brachydanio rerio) Length = 64 Score = 32.7 bits (73), Expect = 0.78 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +1 Query: 106 KQGGKAKPLKQAKVAEKDYDENDLAYLQ 189 ++GGK KPLK K K+ DE+++A+ Q Sbjct: 4 REGGKKKPLKAPKKQSKEMDEDEMAFKQ 31
>Q06DK3:CCD72_ANOFN Coiled-coil domain-containing protein 72 homolog - Anopheles| funestus (African malaria mosquito) Length = 64 Score = 31.6 bits (70), Expect = 1.7 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +1 Query: 106 KQGGKAKPLKQAKVAEKDYDENDLAYLQ 189 ++GGK KPLK K + + D++D+A+ Q Sbjct: 4 REGGKKKPLKAPKKEQSEMDDDDVAFKQ 31
>Q9VG95:GSTT5_DROME Glutathione S-transferase D5 - Drosophila melanogaster (Fruit fly)| Length = 216 Score = 30.0 bits (66), Expect = 5.1 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 5/61 (8%) Frame = -1 Query: 403 MLNTTEGSLLQPQIVKRDTDR*IDRLSFSGHYEWAGR-----LISSHSSSDQILPAHPSG 239 +LNT E L+P+ VK + I L +G W R L+ + D + P P Sbjct: 30 LLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDTLFPKDPKK 89 Query: 238 Q 236 Q Sbjct: 90 Q 90 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 64,754,040 Number of extensions: 1114029 Number of successful extensions: 3385 Number of sequences better than 10.0: 14 Number of HSP's gapped: 3367 Number of HSP's successfully gapped: 14 Length of query: 176 Length of database: 100,686,439 Length adjustment: 106 Effective length of query: 70 Effective length of database: 71,611,169 Effective search space: 5012781830 Effective search space used: 5012781830 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
