| Clone Name | FLbaf149o14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q55423:Y829_SYNY3 Uncharacterized methyltransferase sll0829 - Sy... | 33 | 2.1 | 2 | Q9V4Q0:GR43B_DROME Putative chemosensory receptor 43b - Drosophi... | 33 | 3.6 | 3 | Q12361:GPR1_YEAST G protein-coupled receptor GPR1 - Saccharomyce... | 32 | 6.2 |
|---|
>Q55423:Y829_SYNY3 Uncharacterized methyltransferase sll0829 - Synechocystis sp. (strain| PCC 6803) Length = 212 Score = 33.5 bits (75), Expect = 2.1 Identities = 25/63 (39%), Positives = 33/63 (52%) Frame = +1 Query: 874 HTSYALHQGLYCLVQLIYLMMVKVLRYFLTIALHALHRYSTFVNWELWWPQFPILVYFKE 1053 HTS ALH+ +Q I + +VL+ AL LHR S NW L+WP I + E Sbjct: 111 HTSVALHEMTPAQLQSIISGVHRVLKPGGIFALVDLHRPS---NW-LFWPPLAIFMGLFE 166 Query: 1054 TQT 1062 T+T Sbjct: 167 TET 169
>Q9V4Q0:GR43B_DROME Putative chemosensory receptor 43b - Drosophila melanogaster (Fruit| fly) Length = 430 Score = 32.7 bits (73), Expect = 3.6 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = +1 Query: 829 QVRTYLLVARTVGSKHTSYALHQGLYCLVQLIYLMMV----KVLRYFLTIALHAL 981 +VR +LL+A + ++HTS +HQ L L +I L + V+ Y +T+ L AL Sbjct: 356 KVRPHLLIAMVLENEHTSLIIHQKLKPLENMIILDITCDREFVMDYIVTVILTAL 410
>Q12361:GPR1_YEAST G protein-coupled receptor GPR1 - Saccharomyces cerevisiae (Baker's| yeast) Length = 961 Score = 32.0 bits (71), Expect = 6.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 257 WLWDNRFSGGLLPGLSPKQRYYWCASLLLPA 165 W W N+ SG + GL K+ Y W + L+PA Sbjct: 160 WKWRNKRSGNMEGGLYKKRSYIWPITALVPA 190 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 227,754,042 Number of extensions: 4926179 Number of successful extensions: 11610 Number of sequences better than 10.0: 3 Number of HSP's gapped: 11609 Number of HSP's successfully gapped: 3 Length of query: 455 Length of database: 100,686,439 Length adjustment: 117 Effective length of query: 338 Effective length of database: 68,593,924 Effective search space: 23184746312 Effective search space used: 23184746312 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)