| Clone Name | FLbaf143h22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q01769:PHOSP_PIRYV Phosphoprotein - Piry virus (PIRYV) | 31 | 2.6 |
|---|
>Q01769:PHOSP_PIRYV Phosphoprotein - Piry virus (PIRYV)| Length = 327 Score = 31.2 bits (69), Expect = 2.6 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 230 WITMAERARSGAVKAGMDVRESLSPKQKGDWQD--VALMSLS 349 W M ++ +G + A + + L+PKQ W D +ALM LS Sbjct: 110 WSAMVQKTVNGKLVAELSAPQGLTPKQLSQWTDSVLALMDLS 151 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 70,816,468 Number of extensions: 1207312 Number of successful extensions: 2233 Number of sequences better than 10.0: 1 Number of HSP's gapped: 2233 Number of HSP's successfully gapped: 1 Length of query: 186 Length of database: 100,686,439 Length adjustment: 107 Effective length of query: 79 Effective length of database: 71,336,874 Effective search space: 5635613046 Effective search space used: 5635613046 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)