| Clone Name | FLbaf148h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q8U178:EI2B1_PYRFU Putative translation initiation factor eIF-2B... | 34 | 1.8 | 2 | Q09SZ7:ENV_HTL3P Envelope glycoprotein gp63 precursor - Human T-... | 32 | 9.1 |
|---|
>Q8U178:EI2B1_PYRFU Putative translation initiation factor eIF-2B subunit 1 - Pyrococcus| furiosus Length = 356 Score = 34.3 bits (77), Expect = 1.8 Identities = 24/105 (22%), Positives = 45/105 (42%), Gaps = 4/105 (3%) Frame = +3 Query: 1077 QGVSKVLWMSSSKPTFTRVQLAHARHSYG----NDVSDDMASELKHQHKCKYLYVA*DFF 1244 +G K+LW+ ++P +L+ +SY ++D+ A+ + Q K + V D Sbjct: 190 EGTLKLLWLDETRPVLQGARLSAWEYSYDGLNVKLIADNAAAFVMQQGKVDAIIVGADRI 249 Query: 1245 LYHGTIANSLGEKSG*IAYHHHSYVAHHPCHVTCPMSLVNTQLPS 1379 + +G AN +G + H P P+S ++ L S Sbjct: 250 VANGDFANKIGTYMLAVLAKEHGI----PFFTVAPLSSIDMSLSS 290
>Q09SZ7:ENV_HTL3P Envelope glycoprotein gp63 precursor - Human T-cell leukemia virus| 3 (strain Pyl43) (HTLV-3) Length = 493 Score = 32.0 bits (71), Expect = 9.1 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = +3 Query: 546 WRCYLFHGPISNRLHMAQG----TKENRAVSLHLHVSKKNTSFTFFL 674 W C + GP+SN T+E ++SLHLH SK +SF+F L Sbjct: 120 WTCP-YTGPVSNPHWKYTSDLNFTQEVSSISLHLHFSKCGSSFSFLL 165 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 293,341,838 Number of extensions: 6089492 Number of successful extensions: 12887 Number of sequences better than 10.0: 2 Number of HSP's gapped: 12867 Number of HSP's successfully gapped: 2 Length of query: 623 Length of database: 100,686,439 Length adjustment: 119 Effective length of query: 504 Effective length of database: 68,045,334 Effective search space: 34294848336 Effective search space used: 34294848336 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)