ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf140c09 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os01g27750:12001.t02476:unspliced-genomic shikimate biosynthesis protein aroDE, putative, expressed| Length = 13580 Score = 91.3 bits (193), Expect = 5e-18 Identities = 42/69 (60%), Positives = 44/69 (63%) Frame = +3 / +2 Query: 6 LVGRTVEEMKIDXXXXXXXGGDLVEIRLDYIEGFRPREDLPRLLHSCPLPVLVTYRFDLL 185 LV RTVE M+ D G DLVEIRLD+IEGFRPRE LP LL CPLP LVTYR D Sbjct: 212 LVSRTVEAMQADAAAAAAAGADLVEIRLDFIEGFRPREHLPSLLRGCPLPALVTYR*DPP 391 Query: 186 FACFSIPGL 212 S P L Sbjct: 392 LLSPSTPSL 418 Score = 76.2 bits (160), Expect = 2e-13 Identities = 36/61 (59%), Positives = 40/61 (65%) Frame = -1 / -2 Query: 188 EEEIEPVGDKDGERAAVEQTWKVLPRAEPLDVVQSDLDKVAPCGCCSRRVDLHLLDRPPH 9 E I PVGD+ ERAA EQ +VLPRAEPLD V+ DLD+V G RRV LH L R H Sbjct: 394 ERGISPVGDEGRERAATEQAREVLPRAEPLDEVEPDLDEVGAGGRGRRRVGLHRLHRARH 215 Query: 8 Q 6 Q Sbjct: 214 Q 212 Score = 63.4 bits (132), Expect = 1e-09 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = +2 / +1 Query: 92 LHRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPW 208 LHRGVPPAG P AP LP+P P HLPVRSP L L P+ Sbjct: 298 LHRGVPPAGAPPEPAPWLPSPCPRHLPVRSPSPLALYPF 414 Score = 40.0 bits (81), Expect = 0.014 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = +1 / +3 Query: 55 QPQGATLSRSDWTTSRGSARGRTFHVCSTAA 147 +P T SRS T+SRGSARG T CS AA Sbjct: 261 RPPAPTSSRSGSTSSRGSARGSTSRACSVAA 353
>LOC_Os01g27760:12001.t02477:unspliced-genomic hypothetical protein| Length = 1392 Score = 52.4 bits (108), Expect(2) = 8e-13 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +3 / +1 Query: 105 FRPREDLPRLLHSCPLPVLVTYR 173 FRPREDLPRLL CPLP +VTYR Sbjct: 1210 FRPREDLPRLLRGCPLPAIVTYR 1278 Score = 40.5 bits (82), Expect(2) = 8e-13 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = +3 / +1 Query: 6 LVGRTVEEMKIDXXXXXXXGGDLVEIRLDYI 98 LV RTVE M+ D G DLVEIRLD+I Sbjct: 1108 LVARTVEAMRADAAAAAAAGADLVEIRLDFI 1200 Score = 45.5 bits (93), Expect = 3e-04 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = +2 / +3 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSP 184 VPPAGG AP+LPAPR HL VR+P Sbjct: 1209 VPPAGGSPAPAPRLPAPRHRHLQVRTP 1289 Score = 40.0 bits (81), Expect = 0.014 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 / -1 Query: 173 PVGDKDGERAAVEQTWKVLPRAE 105 PVGD GERAA EQ ++LPRAE Sbjct: 1278 PVGDDGGERAAAEQAREILPRAE 1210
>LOC_Os12g34874:12012.t004204:unspliced-genomic shikimate dehydrogenase, putative, expressed| Length = 5045 Score = 41.8 bits (85), Expect(2) = 7e-06 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = +3 / +3 Query: 15 RTVEEMKIDXXXXXXXGGDLVEIRLDYIEGFRPREDLPRLL 137 R EM + G D+ E+RLD + GF PR DLP LL Sbjct: 135 RAPREMAAELAAAAALGADVAELRLDRLAGFAPRRDLPVLL 257 Score = 27.2 bits (53), Expect(2) = 7e-06 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 / +2 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFG 214 P G P PAPRP HL V L W G Sbjct: 233 PPGPPRPPRAAAPAPRPRHLQVSPLLPRSRLVWCG 337
>LOC_Os09g20000:12009.t01734:unspliced-genomic metal ion binding protein, putative, expressed| Length = 1670 Score = 40.0 bits (81), Expect = 0.014 Identities = 18/47 (38%), Positives = 21/47 (44%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNI 247 P P +AP+ PAP PC SP L+P E SC C I Sbjct: 1050 PAPASPPCAAPRTPAPSPCTASCLSPPTAPLHPSKSKQEFSCQSCMI 910
>LOC_Os07g26400:12007.t02336:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1957 Score = 37.3 bits (75), Expect = 0.092 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +2 / +3 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 V P GP++S P +P+PRP L R PL L+ CS Sbjct: 1812 VSPWHGPASSRPLVPSPRPWFLRRREPLALVARRMRCCS 1928
>LOC_Os04g22600:12004.t01989:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6743 Score = 37.3 bits (75), Expect = 0.092 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +2 / +3 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 V P GP++S P +P PRP L R PL L+ CS Sbjct: 1839 VSPWRGPASSRPLVPGPRPWFLRRREPLALVARRMCCCS 1955
>LOC_Os04g52030:12004.t04679:unspliced-genomic zinc finger domain, LSD1 subclass family protein, expressed| Length = 3126 Score = 36.8 bits (74), Expect = 0.13 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +2 / +1 Query: 104 VPPAGGPSTSAPQLPAPRPCHLP 172 VPPA GP++ AP +PAP P P Sbjct: 466 VPPASGPASRAPLVPAPPPAPFP 534
>LOC_Os05g14560:12005.t01230:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4373 Score = 35.9 bits (72), Expect = 0.24 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 / +1 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 P P+ S PQ PAP P H P SP + L Sbjct: 2413 PPHAPAPSPPQAPAPTPSHAPAPSPPQAL 2499
>LOC_Os03g26750:12003.t02357:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6564 Score = 35.9 bits (72), Expect = 0.24 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +2 / +2 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 V P GP++S P +P+PRP L R PL L+ Sbjct: 1760 VSPWRGPASSRPLVPSPRPWFLRRREPLALV 1852
>LOC_Os12g14400:12012.t01303:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3164 Score = 35.4 bits (71), Expect = 0.33 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +2 / +2 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 GL V P GP+ S P +P+PRP L R PL + CS Sbjct: 1799 GLSLFVSP*RGPALSRPLVPSPRPWFLRRREPLAWVARKMRYCS 1930
>LOC_Os06g21530:12006.t01970:unspliced-genomic ABC-type Co2+ transport system, permease component, putative,| expressed Length = 648 Score = 35.4 bits (71), Expect = 0.33 Identities = 17/51 (33%), Positives = 21/51 (41%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNIRNGR 259 PP S S+P +PRP P P L PW + C + R GR Sbjct: 352 PPPAASSGSSPPPGSPRPSPPPPLRPPPRCLPPWTAAAVRGAACSSSRGGR 200
>LOC_Os06g15150:12006.t01389:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5858 Score = 35.4 bits (71), Expect = 0.33 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +2 / +2 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 GL V P GP++S P +P+PRP L PL L CS Sbjct: 1736 GLSLFVSPWRGPASSRPLVPSPRPWFLRRMEPLALAARRMRCCS 1867
>LOC_Os06g10020:12006.t00880:unspliced-genomic expressed protein| Length = 927 Score = 35.4 bits (71), Expect = 0.33 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 / +1 Query: 107 PPAGGPSTSAPQLPAPRPCHLP 172 PP PS+SAP P+P PC P Sbjct: 223 PPPTSPSSSAPSAPSPPPCSAP 288
>LOC_Os04g37430:12004.t03314:unspliced-genomic lipoxygenase 5, putative, expressed| Length = 4257 Score = 35.4 bits (71), Expect = 0.33 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 G PPA P +AP PAP P P R P Sbjct: 187 GAPPAAPPRAAAPPAPAPPPPAPPARPP 104
>LOC_Os04g21810:12004.t01912:unspliced-genomic ligA, putative| Length = 603 Score = 35.4 bits (71), Expect = 0.33 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 / -2 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 +PP P + PQ APRPC V SP ++ Sbjct: 95 LPPIASPRSPVPQPRAPRPCRRAVASPCAVI 3
>LOC_Os01g49270:12001.t04366:unspliced-genomic XPA-binding protein 2, putative, expressed| Length = 2328 Score = 35.4 bits (71), Expect = 0.33 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +2 / +2 Query: 116 GGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPC 238 G P S+P+ AP P PVR +RL PW + PC Sbjct: 1769 GHPPRSSPRQGAPLPAPRPVRGGVRLRRAPWPSTTRRRGPC 1891
>LOC_Os03g19090:12003.t01676:unspliced-genomic expressed protein| Length = 1634 Score = 28.6 bits (56), Expect(2) = 0.44 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +2 / -2 Query: 116 GGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPC 238 GGP+ A P P +P R P CS +CPC Sbjct: 1105 GGPAGRGGTCAAASPPPAPGSAPRRDARAPPRPCSSAACPC 983 Score = 26.7 bits (52), Expect(2) = 0.44 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 / -1 Query: 257 RADACEESNSERVRRCCSPAWSV 325 R DA + +RVRRC P SV Sbjct: 554 RGDAPRSGDMDRVRRCTDPLRSV 486
>LOC_Os07g17970:12007.t01656:unspliced-genomic 4-coumarate--CoA ligase 2, putative, expressed| Length = 6695 Score = 35.0 bits (70), Expect = 0.45 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 PP S AP P+P P P R P PW G S Sbjct: 888 PPRAPVSRPAPPRPSPPPSSPPARRPAARTRTPWSGTS 775
>LOC_Os01g57890:12001.t05190:unspliced-genomic ATML1, putative, expressed| Length = 6636 Score = 35.0 bits (70), Expect = 0.45 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +3 / +1 Query: 177 DLLFACFSIPGLVVLRFRVRVAIFGTGAQMLAKNQ 281 D LF F+ PGL++L FR+ AIF ++ K++ Sbjct: 1276 DKLF*LFNYPGLLILMFRITKAIFSRRVLLILKSE 1380
>LOC_Os01g39570:12001.t03484:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5455 Score = 35.0 bits (70), Expect = 0.45 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = +2 / +3 Query: 86 TGLHRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 +GL V P GP++ P P+PRP L R PL L CS Sbjct: 1794 SGLSLFVSPWRGPASWRPLAPSPRPWFLRRRKPLALAARRMCCCS 1928
>LOC_Os01g27170:12001.t02421:unspliced-genomic potassium transporter 3, putative, expressed| Length = 5286 Score = 35.0 bits (70), Expect = 0.45 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 / +2 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFG 214 P + P +S+ + RPC + R+ + LLL WFG Sbjct: 2393 PSSSAPPSSSATASSRRPCPVSARTVILLLLGVWFG 2500
>LOC_Os05g29900:12005.t02589:unspliced-genomic expressed protein| Length = 976 Score = 29.9 bits (59), Expect(2) = 0.49 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 / +3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRS 181 PPA P S P PAP P P S Sbjct: 312 PPATSPPRSTPPPPAPSPSRAPTPS 386 Score = 24.4 bits (47), Expect(2) = 0.49 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 / +3 Query: 161 CHLPVRSPLRLLLNPW 208 C VRS + LLL+PW Sbjct: 645 CGCEVRSRILLLLDPW 692
>LOC_Os11g31180:12011.t02718:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3641 Score = 34.5 bits (69), Expect = 0.62 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 / +1 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 P P+ S PQ PAP P H P SP Sbjct: 1798 PPHAPAPSPPQAPAPTPPHAPALSP 1872
>LOC_Os11g27329:12011.t004352:unspliced-genomic serine carboxypeptidase 1 precursor, putative, expressed| Length = 31581 Score = 34.5 bits (69), Expect = 0.62 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 / -1 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 P P+ S PQ PAP P H P SP Sbjct: 18423 PPHAPAPSPPQAPAPSPPHAPAPSP 18349 Score = 32.2 bits (64), Expect = 3.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 / -1 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 P P+ S P PAP P H P SP Sbjct: 18399 PPQAPAPSPPHAPAPSPPHAPTPSP 18325
>LOC_Os08g01510:12008.t00050:unspliced-genomic cytochrome P450 71C4, putative, expressed| Length = 1858 Score = 34.5 bits (69), Expect = 0.62 Identities = 19/67 (28%), Positives = 24/67 (35%) Frame = +2 / +2 Query: 113 AGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNIRNGRADACEESNSER 292 A P +S+P+ PRP P SP R PW S + P A S Sbjct: 167 APSPPSSSPRRAPPRPSSAPTTSPSRRGRAPWSPTSSPTAPPTRATAPTATISARSGRRS 346 Query: 293 VRRCCSP 313 C +P Sbjct: 347 PSTCSTP 367
>LOC_Os01g05990:12001.t00483:unspliced-genomic histone H2B.1, putative, expressed| Length = 814 Score = 34.5 bits (69), Expect = 0.62 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +2 / +2 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 PA PST +P+ P P P LP+R L LL Sbjct: 470 PASLPSTPSPRAPRPSPSSLPLRLHLVLL 556
>LOC_Os07g30200:12007.t02710:unspliced-genomic asparaginyl-tRNA synthetase, putative, expressed| Length = 6458 Score = 30.9 bits (61), Expect(2) = 0.81 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 / +1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVR 178 PP GG +++ P+ P RP H P R Sbjct: 217 PPRGGAASAPPRRPRRRPRHRPPR 288 Score = 25.4 bits (49), Expect(2) = 0.81 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +2 / +2 Query: 317 WSVPLLVFVRPN 352 WSVPL+V++ PN Sbjct: 890 WSVPLVVWLMPN 925
>LOC_Os11g16320:12011.t01412:unspliced-genomic expressed protein| Length = 4509 Score = 34.1 bits (68), Expect = 0.85 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 / +3 Query: 98 RGVPPAGGPSTSAPQLPAPRPC 163 R PPAGGP T+A + +P PC Sbjct: 237 RSPPPAGGPGTAARRRRSPAPC 302
>LOC_Os11g06870:12011.t00579:unspliced-genomic glyoxal oxidase, putative| Length = 1886 Score = 34.1 bits (68), Expect = 0.85 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 G PP+G SA + PAPRP P R R Sbjct: 1593 GTPPSGSSRRSASRTPAPRPPRAPPRGHRR 1504
>LOC_Os08g12300:12008.t01110:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 8191 Score = 34.1 bits (68), Expect = 0.85 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +2 / +2 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 V P GP+ S P P+PRP L R PL L CS Sbjct: 3782 VSPWHGPALSRPLAPSPRPRSLRRREPLALAARRMRCCS 3898
>LOC_Os07g46240:12007.t04260:unspliced-genomic expressed protein| Length = 3750 Score = 34.1 bits (68), Expect = 0.85 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 / -2 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRL 193 P PS AP L P P HLP +P R+ Sbjct: 404 PSPPSPSPPAPPLLCPSPAHLPAAAPARI 318
>LOC_Os06g50390:12006.t04723:unspliced-genomic aspartic-type endopeptidase/ pepsin A, putative, expressed| Length = 2906 Score = 34.1 bits (68), Expect = 0.85 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 / -2 Query: 52 QQPQGATLSRSDWTTSRGSARGRTFHVCSTAA 147 Q Q +R+ WTT GS GR CSTAA Sbjct: 2629 QLQQQQPAARAPWTTGAGSLHGRQLPRCSTAA 2534
>LOC_Os06g34500:12006.t03146:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2578 Score = 34.1 bits (68), Expect = 0.85 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 / +3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSP 184 P P+ S PQ PAP P H P SP Sbjct: 1473 PSPQAPAPSPPQAPAPSPPHAPAPSP 1550
>LOC_Os04g31330:12004.t02816:unspliced-genomic protein binding protein, putative, expressed| Length = 2744 Score = 34.1 bits (68), Expect = 0.85 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 G PP PS +AP+ P PRP R P R Sbjct: 648 GAPPPSAPSRAAPRRPPPRPRRRRRRPPPR 559
>LOC_Os04g23570:12004.t02079:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 8232 Score = 34.1 bits (68), Expect = 0.85 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 / +3 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 P P S PQ PAP P H P SP + L Sbjct: 6249 PPQAPPPSPPQAPAPSPPHAPAPSPPQAL 6335
>LOC_Os04g16240:12004.t01384:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1896 Score = 34.1 bits (68), Expect = 0.85 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +2 / +2 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 V P GP++S P +P+PRP L R P L+ CS Sbjct: 1751 VSPWRGPASSRPLVPSPRPWFLRRREPPALVARRMRCCS 1867
>LOC_Os03g47590:12003.t04120:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3238 Score = 34.1 bits (68), Expect = 0.85 Identities = 20/64 (31%), Positives = 24/64 (37%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNIRNGRADACEES 280 GVP P P PR +P R+P L P G PCC+ R A S Sbjct: 2018 GVPCGPPPPWPPPSAAPPRRAPMPRRAPPALPAGPPSGHLTRPAPCCSRRPRPAGGAPRS 1839 Query: 281 NSER 292 +R Sbjct: 1838 LGQR 1827
>LOC_Os03g21850:12003.t01938:unspliced-genomic expressed protein| Length = 7262 Score = 34.1 bits (68), Expect = 0.85 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 / -2 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 PP G P AP P+P P LP+ P R Sbjct: 211 PPPGSPPPPAPPSPSPPPASLPLPHPHR 128
>LOC_Os02g22510:12002.t02038:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1753 Score = 34.1 bits (68), Expect = 0.85 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 / +3 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 V P GP++S P +P+PRP L R P L CS Sbjct: 1608 VSPRRGPASSRPLVPSPRPWFLRRREPPALAARRMRCCS 1724
>LOC_Os11g36719:12011.t03216:unspliced-genomic lipoxygenase 3, putative, expressed| Length = 9733 Score = 33.6 bits (67), Expect = 1.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 / -3 Query: 206 WFGCSEISCPCCNIRNGRADAC 271 W GC+ +SC C + NG AC Sbjct: 8471 WIGCATLSCRCVAMANGSITAC 8406
>LOC_Os09g03340:12009.t00231:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 915 Score = 33.6 bits (67), Expect = 1.2 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 PP + + P PAP P H+PV +P L Sbjct: 649 PPVPPAAPAVPAAPAPAPAHVPVSAPASAL 738
>LOC_Os08g32550:12008.t03000:unspliced-genomic hypothetical protein| Length = 681 Score = 33.6 bits (67), Expect = 1.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 / -3 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLP 172 G RG P P++S+P P PRP LP Sbjct: 244 GCGRGTPRRRAPTSSSPPRPRPRPRRLP 161
>LOC_Os08g05020:12008.t00396:unspliced-genomic expressed protein| Length = 801 Score = 33.6 bits (67), Expect = 1.2 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 / -3 Query: 122 PSTSAPQLPAPRPCHLPVRSPLRLLLNPW 208 P +S P P R C P PLRLL PW Sbjct: 196 PHSSLPPTPPLRSCARPPPPPLRLLWPPW 110
>LOC_Os07g27570:12007.t02451:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2758 Score = 33.6 bits (67), Expect = 1.2 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 / -1 Query: 86 TGLHRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 TG V P+ G S P L P PCH P PL L Sbjct: 460 TGSSAPVSPSSGSSLPLPILYKPSPCHPPPFPPLAAL 350
>LOC_Os05g49930:12005.t04426:unspliced-genomic DELLA protein GAI, putative, expressed| Length = 1736 Score = 33.6 bits (67), Expect = 1.2 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 / -1 Query: 92 LHRGVPPAGGPSTSAPQLPAPRPCHLP 172 LHR +P AGG PAP+P H P Sbjct: 1319 LHRRLPEAGGAERQLRHPPAPQPLHPP 1239
>LOC_Os05g47960:12005.t04231:unspliced-genomic expressed protein| Length = 811 Score = 33.6 bits (67), Expect = 1.2 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 / -1 Query: 194 LLNPWFGCSEISCPCCNIRNGRADACEESNSERVRR 301 LL P C+ SCPC NG+A + + S + RR Sbjct: 148 LLAPSPSCTTSSCPCQETSNGKATSSQASKPRKRRR 41
>LOC_Os05g27580:12005.t02409:unspliced-genomic wound-induced protein WI12 containing protein| Length = 3642 Score = 33.6 bits (67), Expect = 1.2 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 / -3 Query: 98 RGVPPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 RG P PST++P P+P P P R P R Sbjct: 3451 RGRPSTRAPSTASPWRPSPPPAPSPRRRPRR 3359
>LOC_Os03g15620:12003.t01348:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5829 Score = 33.6 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L +P CS Sbjct: 4340 SGPQLPSPSPSPRPARAPRSCLTSPTG*CS 4429
>LOC_Os03g13460:12003.t01140:unspliced-genomic microtubule-associated protein MAP65-1a, putative, expressed| Length = 7003 Score = 33.6 bits (67), Expect = 1.2 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +2 / -1 Query: 146 PAPRPCHLPVRSPLRLLLNPWF 211 P P P LP SPL LLL+ WF Sbjct: 280 PVPLPLSLPSSSPLLLLLSSWF 215
>LOC_Os02g46570:12002.t04244:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1449 Score = 33.6 bits (67), Expect = 1.2 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 PP + + P PAP P H+PV +P L Sbjct: 649 PPVPPAAPAVPAAPAPAPAHVPVSAPASAL 738
>LOC_Os02g03010:12002.t00201:unspliced-genomic expressed protein| Length = 1426 Score = 33.6 bits (67), Expect = 1.2 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 / +3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRL 193 PP P S P P P P HLP+ P RL Sbjct: 474 PPPPRPPPSPPVTPPPPPPHLPLPHPSRL 560
>LOC_Os02g01140:12002.t00014:unspliced-genomic anther-specific proline-rich protein APG precursor, putative,| expressed Length = 1410 Score = 33.6 bits (67), Expect = 1.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 / -1 Query: 107 PPAGGPSTSAPQLPAPRPCHLP 172 PPA P+T +P +P PR C LP Sbjct: 135 PPAPPPTTPSPPMPPPRYCLLP 70
>LOC_Os01g70770:12001.t06375:unspliced-genomic glutathione S-transferase III, putative, expressed| Length = 1848 Score = 33.6 bits (67), Expect = 1.2 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +2 / -1 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 G RG + GPS SAP PAPR P R+P Sbjct: 285 GGRRGRGRSRGPSRSAPSPPAPRSPTAPSRTP 190
>LOC_Os12g23440:12012.t02073:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6588 Score = 33.1 bits (66), Expect = 1.6 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 / +1 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 V P GP++S P +P+P P L R PL L CS Sbjct: 1750 VSPWRGPASSRPLVPSPPPWFLRRREPLALAARRMRCCS 1866
>LOC_Os12g07280:12012.t00612:unspliced-genomic TRANSPARENT TESTA 1 protein, putative, expressed| Length = 2943 Score = 33.1 bits (66), Expect = 1.6 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 / -1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPW 208 PPA P TS P P P P R R + PW Sbjct: 1896 PPAAAPRTSPPPPPPPDSPSHPARRRQRRRIRPW 1795
>LOC_Os11g26060:12011.t02222:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1565 Score = 33.1 bits (66), Expect = 1.6 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 / +1 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 V P GP++S P +P+PRP L R P L CS Sbjct: 1420 VSPWRGPASSRPLVPSPRPWFLRRREPPALAARRMRCCS 1536
>LOC_Os09g26144:12009.t02293:unspliced-genomic glutamate receptor 2.8 precursor, putative, expressed| Length = 9891 Score = 33.1 bits (66), Expect = 1.6 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +2 / -2 Query: 98 RGVPPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 R PPA +SAP P+ P P RSP R Sbjct: 1520 RAPPPAASARSSAPPTPSAPPSTPPARSPAR 1428
>LOC_Os09g20910:12009.t01825:unspliced-genomic conserved hypothetical protein| Length = 8080 Score = 33.1 bits (66), Expect = 1.6 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 / +1 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 P P S+P P PRP LP RSP Sbjct: 103 PPPAPPPSSPPPPPPRPPRLPARSP 177
>LOC_Os08g33076:12008.t03051:unspliced-genomic myrosinase precursor, putative, expressed| Length = 4788 Score = 33.1 bits (66), Expect = 1.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 / +3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSP 184 PPA P +P LP+PRP P SP Sbjct: 75 PPARAPPLPSPPLPSPRPRRSPDLSP 152
>LOC_Os07g09690:12007.t00843:unspliced-genomic galactosyltransferase/ transferase, transferring hexosyl groups,| putative, expressed Length = 4172 Score = 33.1 bits (66), Expect = 1.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRP 160 PP G PS AP PAPRP Sbjct: 432 PPGGAPSPGAPGPPAPRP 379
>LOC_Os04g05460:12004.t00427:unspliced-genomic hypothetical protein| Length = 3841 Score = 33.1 bits (66), Expect = 1.6 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 / +1 Query: 122 PSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISC 232 P+ +AP APRPCH R+ + +L G S C Sbjct: 1954 PNMAAPATLAPRPCHRGTRAVVEVLTGQNGGTSHTVC 2064
>LOC_Os03g62600:12003.t05486:unspliced-genomic ras-related protein Rab11A, putative, expressed| Length = 1862 Score = 33.1 bits (66), Expect = 1.6 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 / +1 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNIR 250 P+ ++S+P P+ PC L + SPL LL++ + C C +R Sbjct: 328 PSPPSASSSPPAPSRSPCLLVLASPLLLLISSAY*CLLCLCSASVLR 468
>LOC_Os03g17770:12003.t01551:unspliced-genomic conserved hypothetical protein| Length = 1014 Score = 33.1 bits (66), Expect = 1.6 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +2 / -3 Query: 95 HRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 HR V P G + A LP+P P P RSP R Sbjct: 910 HRTVAPLGACRSRAAPLPSPPPAVSPRRSPRR 815
>LOC_Os01g03780:12001.t00268:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5965 Score = 33.1 bits (66), Expect = 1.6 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P + CS Sbjct: 4110 SGPQLPSPSPPPRPARAPRSCLTPPTW*CS 4199
>LOC_Os10g42299:12010.t03458:unspliced-genomic mitochondrial carnitine/acylcarnitine carrier-like protein,| putative, expressed Length = 5352 Score = 31.8 bits (63), Expect(2) = 1.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 / +2 Query: 104 VPPAGGPSTSAPQLPAPRP 160 +PPA PST AP P+ RP Sbjct: 461 LPPANSPSTPAPSTPSSRP 517 Score = 23.1 bits (44), Expect(2) = 1.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 / +3 Query: 156 VLVTYRFDLLFACFSI 203 +LV YRF +F CF I Sbjct: 1470 ILVLYRFF*VFLCFVI 1517
>LOC_Os04g54474:12004.t04919:unspliced-genomic transcription factor TGA4, putative, expressed| Length = 8705 Score = 27.2 bits (53), Expect(2) = 2.0 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 / -3 Query: 89 GLHRGVPPAGGPSTSAPQLPAP 154 G G PP+G P +SA P P Sbjct: 7884 GSRTGRPPSGSPRSSASACPCP 7819 Score = 22.6 bits (43), Expect(2) = 2.0 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +2 / -2 Query: 269 CEESNSERVRRCCSPAWSVPLL 334 CE ++S + CC P S L Sbjct: 7819 CERASSTCIEVCCRPPTSTTCL 7754
>LOC_Os12g40690:12012.t03748:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5897 Score = 32.7 bits (65), Expect = 2.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4042 SGPQLPSPSPSSRPARAPRSCLTPPTG*CS 4131
>LOC_Os12g21730:12012.t01913:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5962 Score = 32.7 bits (65), Expect = 2.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4107 SGPQLPSPSPSPKPARAPRNCLTPPTG*CS 4196
>LOC_Os12g09330:12012.t00812:unspliced-genomic transposon protein, putative, Mariner sub-class| Length = 1325 Score = 32.7 bits (65), Expect = 2.2 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 / -2 Query: 577 FFFFFDTVSSINPYVCVC 524 FFFFFD+ +SI P +C C Sbjct: 454 FFFFFDSKASIPPPICPC 401
>LOC_Os12g01850:12012.t00083:unspliced-genomic vegetative storage protein, putative, expressed| Length = 3279 Score = 32.7 bits (65), Expect = 2.2 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRPCH 166 PPA PS +PQLP P+P H Sbjct: 1504 PPARQPSKQSPQLPNPQPEH 1445
>LOC_Os11g34500:12011.t03003:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5966 Score = 32.7 bits (65), Expect = 2.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4111 SGPQLPSPSPSSRPARAPRSCLTPPTG*CS 4200
>LOC_Os11g21980:12011.t01868:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6685 Score = 32.7 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 / +1 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 V P GP++S P P+P P L R PL L CS Sbjct: 1810 VSPWHGPASSRPLAPSPHPRFLRRREPLALAARRMRCCS 1926
>LOC_Os07g30120:12007.t02702:unspliced-genomic expressed protein| Length = 4691 Score = 32.7 bits (65), Expect = 2.2 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 / -1 Query: 391 TPPCIIS*QIFTQRKLLIELQLHGSLS*EKKNQKSIF 501 T PCII Q +T KL+ E ++HG + + Q F Sbjct: 1700 TLPCIIDLQFYTPEKLVREQEMHGHRTNQATKQTETF 1590
>LOC_Os07g28614:12007.t04694:unspliced-genomic expressed protein| Length = 774 Score = 32.7 bits (65), Expect = 2.2 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRL 193 +AP LPAPRP P PLRL Sbjct: 228 AAPHLPAPRPLPRPPEPPLRL 290
>LOC_Os07g24300:12007.t02127:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 864 Score = 32.7 bits (65), Expect = 2.2 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 / +1 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 VPPA +AP PAP P +PV +P L Sbjct: 619 VPPAVSEVPTAPAAPAPVPAPVPVSAPTSAL 711
>LOC_Os07g18670:12007.t01725:unspliced-genomic conserved hypothetical protein| Length = 1894 Score = 32.7 bits (65), Expect = 2.2 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +2 / -1 Query: 98 RGVPPAGGPSTSAPQLPAPRPCHLPVR 178 R +PP + A +LPA R CHLP R Sbjct: 592 RSLPPPRWRRSEAQRLPASRSCHLPDR 512
>LOC_Os06g04020:12006.t00293:unspliced-genomic histone H1, putative, expressed| Length = 1587 Score = 32.7 bits (65), Expect = 2.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 / -2 Query: 113 AGGPSTSAPQLPAPRPCHLPVRSP 184 A PS S+P P+P P H P SP Sbjct: 284 ASSPSVSSPSSPSPSPSHPPPSSP 213
>LOC_Os05g27140:12005.t02366:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4768 Score = 32.7 bits (65), Expect = 2.2 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 / +1 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 P P+ S PQ PAP P H P SP Sbjct: 2833 PPQDPAPSPPQDPAPSPPHAPAPSP 2907
>LOC_Os04g46210:12004.t04153:unspliced-genomic transposon protein, putative, Mariner sub-class| Length = 1869 Score = 32.7 bits (65), Expect = 2.2 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 / -1 Query: 577 FFFFFDTVSSINPYVCVC 524 FFFFFD+ +SI P +C C Sbjct: 720 FFFFFDSKASIPPPICPC 667
>LOC_Os04g35890:12004.t03259:unspliced-genomic protein kinase, putative, expressed| Length = 2846 Score = 32.7 bits (65), Expect = 2.2 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +2 / -1 Query: 98 RGVPPAGGPSTSAPQLPAP 154 RG+PP PST AP LPAP Sbjct: 710 RGLPPHHLPSTIAPHLPAP 654
>LOC_Os04g21130:12004.t01846:unspliced-genomic expressed protein| Length = 3859 Score = 32.7 bits (65), Expect = 2.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 / +2 Query: 88 WTTSRGSARGRTFHVCSTAA 147 WT SRG+ARGR CS+A+ Sbjct: 209 WTVSRGAARGRARRRCSSAS 268
>LOC_Os03g36100:12003.t03084:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 810 Score = 32.7 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 / +2 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 V P GP++S P +P+P P L R PL L CS Sbjct: 665 VSP*RGPASSRPLVPSPPPWFLRRREPLALAARRMRCCS 781
>LOC_Os03g31920:12003.t02786:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 969 Score = 32.7 bits (65), Expect = 2.2 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 / +1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 PPA +AP PAP P +PV +P+ L Sbjct: 652 PPAPPAVPAAPAAPAPAPAPVPVSAPMSAL 741
>LOC_Os03g25869:12003.t02280:unspliced-genomic expressed protein| Length = 7899 Score = 32.7 bits (65), Expect = 2.2 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -1 / -1 Query: 209 TRD*EASEEEIEPVGDKDGERAAVEQTWKVLPRAE 105 +RD + + E VGD+ ER V+ +VLPRAE Sbjct: 564 SRDGDRRGDAAEVVGDEGRERGEVDDAAEVLPRAE 460
>LOC_Os02g32360:12002.t02879:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 7790 Score = 32.7 bits (65), Expect = 2.2 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 / +1 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 P P+ S PQ PAP P H P SP Sbjct: 5830 PPQDPAPSPPQDPAPSPPHAPAPSP 5904
>LOC_Os01g34140:12001.t02976:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 8070 Score = 32.7 bits (65), Expect = 2.2 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 / +3 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 P P+ S PQ PAP P H P SP Sbjct: 6111 PPQDPAPSPPQDPAPSPPHAPAPSP 6185
>LOC_Os06g12870:12006.t01163:unspliced-genomic expressed protein| Length = 2054 Score = 25.8 bits (50), Expect(2) = 2.3 Identities = 10/29 (34%), Positives = 11/29 (37%) Frame = +2 / +1 Query: 233 PCCNIRNGRADACEESNSERVRRCCSPAW 319 P R GR R RRC P+W Sbjct: 1450 PARATRRGRTRTARRRPGTRRRRCARPSW 1536 Score = 24.0 bits (46), Expect(2) = 2.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 / +2 Query: 113 AGGPSTSAPQLPAPRP 160 AGGP + PAPRP Sbjct: 1310 AGGPPDARRDHPAPRP 1357
>LOC_Os05g15520:12005.t01323:unspliced-genomic expressed protein| Length = 4587 Score = 30.9 bits (61), Expect(2) = 2.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 / +1 Query: 230 CPCCNIRNGRADAC 271 CPCCN+ +G D C Sbjct: 2806 CPCCNVLSGLCDVC 2847 Score = 23.1 bits (44), Expect(2) = 2.6 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 / +1 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLP 172 G+P +G T++ PCH+P Sbjct: 1792 GLPVSGSFGTASTHQQWDPPCHVP 1863
>LOC_Os09g17190:12009.t01506:unspliced-genomic F-box domain containing protein, expressed| Length = 1681 Score = 29.0 bits (57), Expect(2) = 2.7 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 / +1 Query: 206 WFGCSEISCPCCNIRNGRADACEESNSERVRRCCS 310 W GC C R G + + +S R RR CS Sbjct: 1141 WCGCRRRRGDCRGTRRGTSSRTKP*SSRRTRRTCS 1245 Score = 23.5 bits (45), Expect(2) = 2.7 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 / +2 Query: 107 PPAGGPSTSAPQLPAPRP 160 PP G P P L PRP Sbjct: 161 PPRGHPPPPRPLLRLPRP 214
>LOC_Os12g42680:12012.t03942:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5959 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4104 SGPQLPSPSPSPRPARAPRSCLTPPTG*CS 4193
>LOC_Os11g35030:12011.t03052:unspliced-genomic expressed protein| Length = 3601 Score = 32.2 bits (64), Expect = 3.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 / -3 Query: 218 SEISCPCCNIRNGRADACEESNSERVRRCC 307 S + CC+I G A S+S R RR C Sbjct: 566 SSVHLTCCSIGGGEAQHLPSSSSSRTRRAC 477
>LOC_Os11g34600:12011.t03012:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5580 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4085 SGPQLPSPSPSPRPARAPRSCLTPPTG*CS 4174
>LOC_Os10g08570:12010.t00677:unspliced-genomic RNA recognition motif family protein, expressed| Length = 6543 Score = 32.2 bits (64), Expect = 3.0 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +2 / -3 Query: 92 LHRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNP 205 LH VPP P+ P P P P +P P LL P Sbjct: 493 LHLQVPPPPSPTLLVPHPPLPLPLLVPHPPPALLLPRP 380
>LOC_Os09g37230:12009.t03197:unspliced-genomic ATP binding protein, putative, expressed| Length = 7275 Score = 32.2 bits (64), Expect = 3.0 Identities = 15/51 (29%), Positives = 21/51 (41%) Frame = +2 / -1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNIRNGR 259 P P+ + PAPR + R P +PW C+ P I +GR Sbjct: 687 PARRKPAAAPDPSPAPRAAYASARPPPSPRSHPWRNCNTNQKPTPQISSGR 535
>LOC_Os09g23270:12009.t02011:unspliced-genomic hypothetical protein| Length = 1441 Score = 32.2 bits (64), Expect = 3.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 / +2 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSP 184 PPAG S+S +LPAP P P P Sbjct: 881 PPAGDESSSPRRLPAPPPPRYPPHGP 958
>LOC_Os08g05310:12008.t00425:unspliced-genomic expressed protein| Length = 2832 Score = 32.2 bits (64), Expect = 3.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 / +1 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLPVRS 181 G R + G P+ AP+LP RPC P+ S Sbjct: 193 GAGRVIQLLGAPARDAPRLPLLRPCFAPLPS 285
>LOC_Os06g31910:12006.t02890:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4628 Score = 32.2 bits (64), Expect = 3.0 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 / +2 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 GL V P GP++S P +P+PRP L P L CS Sbjct: 1745 GLSLFVSPWRGPASSRPLVPSPRPWFLRRMEPPALAARRMRCCS 1876
>LOC_Os05g50520:12005.t04484:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4705 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEIS 229 S PQLP+P P P R+P L P CS ++ Sbjct: 2849 SGPQLPSPSPPPRPARAPRSCLTPPTG*CSSMA 2947
>LOC_Os05g45620:12005.t04050:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4662 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4109 SGPQLPSPSPSPRPARAPRSCLTPPTG*CS 4198
>LOC_Os05g33980:12005.t02993:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5962 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4107 SGPQLPSPSPSPRPARAPRSCLTPPTG*CS 4196
>LOC_Os04g37619:12004.t03331:unspliced-genomic zeaxanthin epoxidase, chloroplast precursor, putative, expressed| Length = 7171 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -2 / -3 Query: 301 SAHPFRI*FFASICAPVPNIATRTRNLRTTKP 206 +++PFR+ AS P+P AT TR LR P Sbjct: 518 TSYPFRLAASASTSPPMPPPATSTRGLRVPSP 423
>LOC_Os04g31860:12004.t02866:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6190 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4335 SGPQLPSPSPSPRPARAPRSCLTPPTG*CS 4424
>LOC_Os04g04730:12004.t00357:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2615 Score = 32.2 bits (64), Expect = 3.0 Identities = 20/64 (31%), Positives = 23/64 (35%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNIRNGRADACEES 280 GVP P P PR P R+P L P GC P C+ R A S Sbjct: 1926 GVPCGPLPPWPPPSAAPPRRTPTPRRAPPALPAGPPSGCLTRPAPWCSQRPRPAGGAPRS 1747 Query: 281 NSER 292 +R Sbjct: 1746 AGQR 1735
>LOC_Os04g01040:12004.t00004:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6664 Score = 32.2 bits (64), Expect = 3.0 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +2 / +3 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNIR 250 V P GP++S P +P+PRP L P L CS C + R Sbjct: 1752 VSPWRGPASSRPLVPSPRPWFLRRMEPPALAARRMRCCSPSILACRSCR 1898
>LOC_Os03g45680:12003.t03940:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1799 Score = 32.2 bits (64), Expect = 3.0 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 / +1 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSP 184 V P GP++S P +P+PRP L R P Sbjct: 1654 VSPWRGPASSRPLVPSPRPWFLRRREP 1734
>LOC_Os03g44390:12003.t03827:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5886 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4031 SGPQLPSPSPSPRPARAPRSCLTPPTG*CS 4120
>LOC_Os03g42130:12003.t03620:unspliced-genomic gibberellin 20 oxidase 2, putative, expressed| Length = 2008 Score = 32.2 bits (64), Expect = 3.0 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 / -2 Query: 95 HRGVPPAGGPSTSAPQLPAPR 157 HRG PP PS +P P PR Sbjct: 276 HRGAPPRRSPSPGSPSRPPPR 214
>LOC_Os03g38570:12003.t03300:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6173 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4318 SGPQLPSPSPSPRPARAPSSCLTPPTG*CS 4407
>LOC_Os03g12360:12003.t01035:unspliced-genomic trehalose-6-phosphate synthase, putative, expressed| Length = 4437 Score = 32.2 bits (64), Expect = 3.0 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +2 / +3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNP 205 P GG A QL R HL +R+PL LLL P Sbjct: 1776 PRPGGAPARAAQLRPHRLPHLRLRAPLPLLLRP 1874
>LOC_Os02g52580:12002.t04839:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3467 Score = 32.2 bits (64), Expect = 3.0 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNP 205 PP P SAP PA R H R P R L +P Sbjct: 180 PPPASPRRSAPTAPAHRRPHRRARRPRRPLPSP 82
>LOC_Os02g19200:12002.t01713:unspliced-genomic F-box domain containing protein, expressed| Length = 5446 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 / +1 Query: 98 RGVPPAGGPSTSAPQLPAPRPCHLPVRSPLRL 193 RG PP P P LP PR L +P RL Sbjct: 196 RGPPPRDPPPPRPPHLPRPRRARLQALAPPRL 291
>LOC_Os01g54690:12001.t04885:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5048 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 3664 SGPQLPSPSPSPRPARAPRSCLTPPTG*CS 3753
>LOC_Os01g43800:12001.t03894:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5390 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4090 SGPQLPSPSPSPRPARAPRSCLTPPTG*CS 4179
>LOC_Os01g17360:12001.t01580:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5677 Score = 32.2 bits (64), Expect = 3.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4107 SGPQLPSPSPSPRPARAPRSCLTPPTR*CS 4196
>LOC_Os01g05950:12001.t00479:unspliced-genomic histone H2B.1, putative, expressed| Length = 777 Score = 32.2 bits (64), Expect = 3.0 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 / +3 Query: 110 PAGGPSTSAPQLPAPRPCHLPVR 178 PA PST +P+ P P P LP R Sbjct: 468 PASSPSTPSPRAPRPLPSSLPPR 536
>LOC_Os03g49520:12003.t04300:unspliced-genomic pinin/SDK/memA/ protein conserved region containing protein,| expressed Length = 3915 Score = 29.5 bits (58), Expect(2) = 3.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 / +1 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRP 160 GL RG P A GP P PRP Sbjct: 232 GLRRGAPAAAGPGGPRPLRGFPRP 303 Score = 24.0 bits (46), Expect(2) = 3.1 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 / +3 Query: 209 FGCSEISCPCCNIRNG 256 FGC + C C N+ G Sbjct: 750 FGCRSLICHCQNLSRG 797
>LOC_Os07g31870:12007.t04717:unspliced-genomic expressed protein| Length = 20526 Score = 28.6 bits (56), Expect(2) = 3.9 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +2 / +1 Query: 146 PAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNIRNGRADA 268 P P HLP+R P L P F C + P R RA A Sbjct: 15787 PPFSPLHLPLRLPSPLSTAPPFPCRCAAVPVPPRRRSRAAA 15909 Score = 26.7 bits (52), Expect(2) = 3.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 / +3 Query: 104 VPPAGGPSTSAPQLPAPR 157 VPP PS +P +P+PR Sbjct: 15483 VPPPRAPSRPSPTVPSPR 15536
>LOC_Os05g27890:12005.t02440:unspliced-genomic expressed protein| Length = 3674 Score = 28.1 bits (55), Expect(2) = 3.9 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +2 / -3 Query: 215 CSEISCPCCNIRNGRADACEESNSERVRRCCSPAWSVPLLVFVRP 349 C+ PCC R GR R CCS S RP Sbjct: 393 CARRPTPCCGRRAGRTGRRRGRRPRRRGTCCSGRRSTAAARSARP 259 Score = 24.9 bits (48), Expect(2) = 3.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 / -3 Query: 122 PSTSAPQLPAPRP 160 PST +P+ P PRP Sbjct: 2958 PSTRSPRTPLPRP 2920
>LOC_Os05g25840:12005.t02239:unspliced-genomic ubiquinone biosynthesis protein ubiB, putative, expressed| Length = 3829 Score = 30.9 bits (61), Expect(2) = 4.1 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 / +3 Query: 98 RGVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFG 214 RG+PP AP PAP P L R+ L L + P G Sbjct: 81 RGLPPRARARAPAPPRPAPPPRRLHRRATLLLPVVPVSG 197 Score = 22.1 bits (42), Expect(2) = 4.1 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +2 / +1 Query: 194 LLNPWFGCSEISCPC 238 L N CS++ CPC Sbjct: 793 LANVACSCSKMECPC 837
>LOC_Os12g44100:12012.t04076:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 4568 Score = 31.8 bits (63), Expect = 4.2 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 / -2 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSP 184 PP P T+A P PR C P R P Sbjct: 3433 PPPAAPCTAATGSPPPRSCRPPPRPP 3356
>LOC_Os12g04640:12012.t00352:unspliced-genomic major facilitator superfamily protein| Length = 1568 Score = 31.8 bits (63), Expect = 4.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVR 178 PP+ PSTS+P +PAP L +R Sbjct: 126 PPSAAPSTSSPSVPAPPLASLLLR 55
>LOC_Os11g38540:12011.t03397:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6138 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4283 SGPQLPSPSPFPRPTRAPRSCLTPPTG*CS 4372
>LOC_Os11g34410:12011.t02994:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5640 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 3785 SGPQLPSPSPSPRPARAPRSCLTPPIG*CS 3874
>LOC_Os11g04330:12011.t00326:unspliced-genomic kelch motif family protein, expressed| Length = 1479 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 / +1 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSPLRL 193 G P P P++P PRP LP +P RL Sbjct: 211 GTPNLHPPRRPPPRVPRPRPPRLPPSAPRRL 303
>LOC_Os10g40900:12010.t03330:unspliced-genomic flavonol synthase/flavanone 3-hydroxylase, putative| Length = 2812 Score = 31.8 bits (63), Expect = 4.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 / -2 Query: 110 PAGGPSTSAPQLPAPRPCHLP 172 PA GP TS PA RPC P Sbjct: 1875 PAAGPGTSPAATPASRPCPSP 1813
>LOC_Os10g34540:12010.t02749:unspliced-genomic tetratricopeptide repeat protein 1, putative, expressed| Length = 4720 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 / -3 Query: 86 TGLHRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 TG + +PP ++ P+ P PR H P PLR Sbjct: 392 TGRPKALPPGAARRSARPRRPPPRLPHPPSPPPLR 288
>LOC_Os09g28210:12009.t02499:unspliced-genomic DNA binding protein, putative, expressed| Length = 1265 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 / +2 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSE 223 PP P SAP P PC +R LL W E Sbjct: 812 PPPTAPPHSAPPTQLPYPCSTTLRGSCTLLAPTWIDGDE 928
>LOC_Os09g18370:12009.t01622:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3698 Score = 31.8 bits (63), Expect = 4.2 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +2 / +2 Query: 212 GCSEISCPCCNIRNGRADACEESNSERVRRCCSPAWS 322 G + +S C G A+ + R +RCC P WS Sbjct: 362 GITCLSVRCTGEEQGHAEIMRALSQIRRKRCCGPQWS 472
>LOC_Os09g12170:12009.t01006:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1787 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 / +3 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 P P+ S PQ PAP P H P SP Sbjct: 999 PP*DPAPSPPQDPAPSPPHAPAPSP 1073
>LOC_Os08g35390:12008.t03279:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5808 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4109 SGPQLPSPSPPSRPARAPRSCLTPPTG*CS 4198
>LOC_Os08g32060:12008.t02951:unspliced-genomic spotted leaf protein 11, putative, expressed| Length = 2433 Score = 31.8 bits (63), Expect = 4.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 / -2 Query: 122 PSTSAPQLPAPRPCHLPVRS 181 PS+S P PAP P H P R+ Sbjct: 920 PSSSPPSAPAPAPAHQPCRN 861
>LOC_Os08g14260:12008.t01301:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 558 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 / +1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 PPA +AP +PAP P +PV +P L Sbjct: 241 PPAPPTVPAAPAVPAPVPASVPVSAPASAL 330
>LOC_Os07g47700:12007.t04404:unspliced-genomic UDP-glucuronic acid decarboxylase 1, putative, expressed| Length = 3411 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 / -2 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRS 181 PP G PS+SAP AP P P RS Sbjct: 452 PPRGAPSSSAPAARAPPPPPPPRRS 378
>LOC_Os07g28840:12007.t02574:unspliced-genomic SET domain containing protein, expressed| Length = 3499 Score = 31.8 bits (63), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 / +1 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPC 238 PA T P P P P P P R P GC I C Sbjct: 391 PAAASWTMTPGSPPPSPATSPASPPSR*FHMPMSGCLRIDLSC 519
>LOC_Os07g27980:12007.t02490:unspliced-genomic hypothetical protein| Length = 2699 Score = 31.8 bits (63), Expect = 4.2 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 / +3 Query: 218 SEISCPCCNIRNGRADACEESNSERVRRCCSPA 316 +E S P C R GR A S R RR CS A Sbjct: 618 TEQSRPRCRRRRGRGSAATTSRRRRRRRACSSA 716
>LOC_Os06g20160:12006.t01833:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3224 Score = 31.8 bits (63), Expect = 4.2 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 G PP P ++AP AP PC P P Sbjct: 1992 GPPPPWPPPSAAPPRRAPTPCRAPPAGP 1909
>LOC_Os05g37580:12005.t03300:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3217 Score = 31.8 bits (63), Expect = 4.2 Identities = 22/76 (28%), Positives = 27/76 (35%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNIRNGRADACEES 280 GVP P P PR P R+P P G PCC+ R A S Sbjct: 1997 GVPCGPPPPWPPPSAAPPRRAPTPRRAPPAPPAGPPSGHLTRPAPCCSRRPRPAGGAPRS 1818 Query: 281 NSERVRRCCSPAWSVP 328 +R +P+ VP Sbjct: 1817 VGQRKAEGRAPSVWVP 1770
>LOC_Os05g30560:12005.t02655:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2901 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 1046 SGPQLPSPSPPSRPARAPRSCLTPPTG*CS 1135
>LOC_Os05g16230:12005.t01393:unspliced-genomic expressed protein| Length = 1110 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 PPA S+S + APRP P +P R L Sbjct: 287 PPATASSSSTSPISAPRPASSPTAAPARRL 376
>LOC_Os05g09090:12005.t00786:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2382 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 779 SGPQLPSPSPFPRPTRAPRSCLTPPTG*CS 868
>LOC_Os04g51540:12004.t04631:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6155 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4300 SGPQLPSPSPFPRPTRAPRSCLTPPTG*CS 4389
>LOC_Os04g32580:12004.t02937:unspliced-genomic expressed protein| Length = 2296 Score = 31.8 bits (63), Expect = 4.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSP 184 PP GP T++P APRP P +P Sbjct: 293 PPRRGPPTASPTAAAPRPRPPPTTTP 216
>LOC_Os04g14270:12004.t01246:unspliced-genomic latency associated nuclear antigen, putative| Length = 639 Score = 31.8 bits (63), Expect = 4.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 / -1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVR 178 PP+ PS P P PRP H P R Sbjct: 624 PPSPPPSPPPPSPPPPRPLHRPPR 553
>LOC_Os04g11170:12004.t00945:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3247 Score = 31.8 bits (63), Expect = 4.2 Identities = 19/64 (29%), Positives = 23/64 (35%) Frame = +2 / -2 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNIRNGRADACEES 280 GVP P P PR P R+P P +G PCC+ R A S Sbjct: 2028 GVPCGPPPPWPPPSAAPPRRAPTPRRAPPSPPARPPYGHLTRPAPCCSRRPRPAGGAPRS 1849 Query: 281 NSER 292 +R Sbjct: 1848 VGQR 1837
>LOC_Os04g08440:12004.t00712:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6154 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4299 SGPQLPSPSPFPRPARAPRSCLTPPTG*CS 4388
>LOC_Os04g06690:12004.t00547:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4701 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 / +2 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 PP P+ S PQ PAP P P +P R Sbjct: 1799 PPHAPPAPSPPQAPAPTPPQDPAPTPPR 1882
>LOC_Os03g30160:12003.t02627:unspliced-genomic kelch motif family protein| Length = 1202 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 / +3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSPLRL 193 G P P P++P PRP LP +P RL Sbjct: 138 GTPNLRPPRRPPPRVPRPRPPRLPPSAPRRL 230
>LOC_Os03g27980:12003.t02471:unspliced-genomic glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed| Length = 1776 Score = 31.8 bits (63), Expect = 4.2 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRS 181 PP T+AP P P P H P R+ Sbjct: 82 PPPASRGTAAPPPPTPPPAHAPART 8
>LOC_Os03g25840:12003.t02278:unspliced-genomic cationic amino acid transporter, putative, expressed| Length = 993 Score = 31.8 bits (63), Expect = 4.2 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -1 / -1 Query: 206 RD*EASEEEIEPVGDKDGERAAVEQTWKVLPRAE 105 RD + + E VGD+ ER V+ +VLPRAE Sbjct: 525 RDGDGRCDAAEVVGDEGRERGEVDDAAEVLPRAE 424
>LOC_Os03g06560:12003.t00523:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6157 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4302 SGPQLPSPSPFPRPTRAPRSCLTPPTG*CS 4391
>LOC_Os02g28540:12002.t02548:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2085 Score = 31.8 bits (63), Expect = 4.2 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 / +1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 PPA +AP PAP P +PV +P+ L Sbjct: 1768 PPASPAVPAAPAAPAPVPAPVPVLAPVSAL 1857
>LOC_Os02g15520:12002.t01345:unspliced-genomic transposon protein, putative, Ac/Ds sub-class, expressed| Length = 2437 Score = 31.8 bits (63), Expect = 4.2 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -1 / -1 Query: 311 VSSICAPVPNLILRKHLRARSEYCN 237 V + AP+P+++ R+HL R+E+ N Sbjct: 964 VEELIAPLPDIVSRRHLEVRAEHPN 890
>LOC_Os01g57260:12001.t05132:unspliced-genomic VPS28 protein homolog 2, putative, expressed| Length = 1103 Score = 31.8 bits (63), Expect = 4.2 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +2 / +2 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCP 235 P + P P+ P PR P S R LL PW S P Sbjct: 461 PSSSAPRRPRPRRPPPRRPRPPSPSASRALLPPWMPSSSTCSP 589
>LOC_Os07g04970:12007.t00382:unspliced-genomic transferase, putative, expressed| Length = 1562 Score = 28.1 bits (55), Expect(2) = 4.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 / +2 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 PA P TS P AP P R+P Sbjct: 245 PAASPPTSTPAAAAPSPSTATARAP 319 Score = 23.5 bits (45), Expect(2) = 4.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 / +1 Query: 389 TPHHVLLVSKYSHNANC*LSSSSMDPLV 472 TP H+LLV+ + A +S SS D +V Sbjct: 1381 TPDHLLLVNDNNDKA*SLISFSSHDNIV 1464
>LOC_Os05g33000:12005.t02895:unspliced-genomic RING zinc finger protein, putative, expressed| Length = 4536 Score = 27.6 bits (54), Expect(2) = 4.7 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = +2 / +2 Query: 215 CSEISCPCCNIRNGRADACEES 280 C + CPCC N + C S Sbjct: 4235 CLPVCCPCCGSSNNELEWCMRS 4300 Score = 25.4 bits (49), Expect(2) = 4.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 / +3 Query: 107 PPAGGPSTSAPQLPAPRP 160 PPA S +AP PAP P Sbjct: 306 PPAATASPAAPPPPAPLP 359
>LOC_Os02g43250:12002.t03910:unspliced-genomic receptor-like protein kinase precursor, putative, expressed| Length = 1343 Score = 25.8 bits (50), Expect(2) = 5.3 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 / +2 Query: 230 CPCCNIRNGRADACEESNSERVRRCCSPAW 319 C C R R A ++ R RRC + W Sbjct: 815 CGCSTSRAMRCPARSQAPRSRTRRCSNCGW 904 Score = 25.4 bits (49), Expect(2) = 5.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 / +3 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 G+ R P G P++P PR LP R+P Sbjct: 327 GVLRHAPRHGPRLAPFPRVPLPRQQPLPRRAP 422
>LOC_Os01g72710:12001.t06558:unspliced-genomic expressed protein| Length = 3785 Score = 28.6 bits (56), Expect(2) = 5.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 / +2 Query: 505 VLKNSENRHIHMDLYYSQCQK 567 +L +E+RH+HM Y QC + Sbjct: 3473 LLVKAEDRHLHMSNSYQQCHR 3535 Score = 24.0 bits (46), Expect(2) = 5.4 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 / +2 Query: 122 PSTSAPQLPAPRPCHLPVRSP 184 PS SA P P P RSP Sbjct: 455 PSASASAFPVPNFLRCPSRSP 517
>LOC_Os11g19864:12011.t01756:unspliced-genomic transposon protein, putative, Pong sub-class, expressed| Length = 9316 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 / +2 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLP 172 GL R PA P+T+ P LPA P P Sbjct: 4946 GLKRSSAPAPSPATAQPPLPASSPPEAP 5029
>LOC_Os10g30220:12010.t02356:unspliced-genomic hypothetical protein| Length = 832 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 / +2 Query: 98 RGVPPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 R V AG TS+P P+P PC + SP R Sbjct: 32 RVVMAAGPARTSSPARPSPSPCGAGLSSPRR 124
>LOC_Os10g28470:12010.t02199:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5963 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4108 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 4197
>LOC_Os10g11570:12010.t00952:unspliced-genomic hypothetical protein| Length = 1744 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 / -1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPL 187 P G T +P P PR C P+R PL Sbjct: 193 PALGFAGTPSPAPPLPRSCRHPLRQPL 113
>LOC_Os10g11550:12010.t00950:unspliced-genomic hypothetical protein| Length = 474 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPL 187 P G T +P P PR C P+R PL Sbjct: 190 PALGFAGTPSPAPPLPRSCRHPLRQPL 110
>LOC_Os09g23150:12009.t01999:unspliced-genomic monoglyceride lipase, putative, expressed| Length = 4672 Score = 31.3 bits (62), Expect = 5.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 / -3 Query: 113 AGGPSTSAPQLPAPRPCHLPVRSP 184 +G PS ++P PAP PC P P Sbjct: 338 SGSPSPASPPRPAPPPCSTPPPPP 267
>LOC_Os09g18440:12009.t01629:unspliced-genomic transposon protein, putative, Pong sub-class| Length = 2171 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 / +1 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLP 172 GL R PA P+T+ P LPA P P Sbjct: 79 GLKRSSAPAPSPATAQPPLPASSPPEAP 162
>LOC_Os09g14250:12009.t01214:unspliced-genomic transposon protein, putative, Pong sub-class| Length = 2509 Score = 31.3 bits (62), Expect = 5.7 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNP 205 PP+ PS A LP+ H ++PLRLLL+P Sbjct: 2423 PPSAYPSHLAFFLPSTPLSHFLPQTPLRLLLSP 2325
>LOC_Os09g12790:12009.t01069:unspliced-genomic calcium-activated outward-rectifying potassium channel 6, putative,| expressed Length = 4123 Score = 31.3 bits (62), Expect = 5.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 / +3 Query: 125 STSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCP 235 S+S + P P P+RSP+ L P C EIS P Sbjct: 12 SSSHRRRPPGTPRIRPIRSPICFSLGPRESCEEISLP 122
>LOC_Os08g43120:12008.t04039:unspliced-genomic ABC transporter, putative, expressed| Length = 9458 Score = 31.3 bits (62), Expect = 5.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 / +1 Query: 272 EESNSERVRRCCSPAWSVPLL 334 E S++ER R+ C+P W PLL Sbjct: 8260 ELSSTERRRQACTPLWRTPLL 8322
>LOC_Os08g23580:12008.t02130:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 8290 Score = 31.3 bits (62), Expect = 5.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 / +2 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 P P+++ PQ PAP P H P +P Sbjct: 6395 PPQAPASTPPQDPAPTPPHAPTPTP 6469
>LOC_Os08g09500:12008.t00835:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5517 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4109 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 4198
>LOC_Os07g47680:12007.t04402:unspliced-genomic transposon protein, putative, Pong sub-class| Length = 777 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 / -3 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLP 172 GL R PA P+T+ P LPA P P Sbjct: 85 GLKRSSAPAPSPATAQPPLPASSPPEAP 2
>LOC_Os07g37470:12007.t03416:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5504 Score = 31.3 bits (62), Expect = 5.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 / +3 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 P P+++ PQ PAP P H P +P Sbjct: 3609 PPQAPASTPPQDPAPTPPHAPTPTP 3683
>LOC_Os07g31630:12007.t02850:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5151 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 3296 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 3385
>LOC_Os07g28540:12007.t02544:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3396 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 G PP P ++AP AP PC P P Sbjct: 2164 GPPPPWPPPSAAPPRRAPTPCRAPPAPP 2081
>LOC_Os07g09240:12007.t00799:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5382 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 3296 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 3385
>LOC_Os07g09230:12007.t00798:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3243 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 G PP P ++AP AP PC P P Sbjct: 2011 GPPPPWPPPSAAPPRRAPTPCRAPPAPP 1928
>LOC_Os06g46890:12006.t04375:unspliced-genomic zinc finger C-x8-C-x5-C-x3-H type family protein, expressed| Length = 5548 Score = 31.3 bits (62), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 / +2 Query: 107 PPAGGPSTSAPQLPAPRP 160 PP GGP AP LP P P Sbjct: 272 PPRGGPGMRAPPLPPPLP 325
>LOC_Os06g36870:12006.t03382:unspliced-genomic transposon protein, putative, Pong sub-class| Length = 2171 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 / +1 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLP 172 GL R PA P+T+ P LPA P P Sbjct: 79 GLKRSSAPAPSPATAQPPLPASSPPEAP 162
>LOC_Os06g34000:12006.t03096:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2425 Score = 31.3 bits (62), Expect = 5.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 / +3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSP 184 PP P+ + PQ PAP P P +P Sbjct: 615 PPPQAPAPTPPQAPAPTPPRAPTPTP 692
>LOC_Os06g30030:12006.t02707:unspliced-genomic plant-specific domain TIGR01570 family protein, expressed| Length = 1579 Score = 31.3 bits (62), Expect = 5.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / +1 Query: 206 WFGCSEISCPCCNIRNGRADA 268 W GC + CPC R ADA Sbjct: 619 WRGCGRLCCPCWRARGEAADA 681
>LOC_Os06g21516:12006.t01969:unspliced-genomic transposon protein, putative, Pong sub-class| Length = 2171 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 / +1 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLP 172 GL R PA P+T+ P LPA P P Sbjct: 79 GLKRSSAPAPSPATAQPPLPASSPPEAP 162
>LOC_Os06g21489:12006.t01966:unspliced-genomic transposon protein, putative, Pong sub-class| Length = 2171 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 / +1 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLP 172 GL R PA P+T+ P LPA P P Sbjct: 79 GLKRSSAPAPSPATAQPPLPASSPPEAP 162
>LOC_Os06g20170:12006.t01834:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5692 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4110 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 4199
>LOC_Os06g03800:12006.t00271:unspliced-genomic ankyrin repeat domain-containing protein 28, putative, expressed| Length = 5339 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 / +2 Query: 86 TGLHRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 TGL+ PP+ + + LPA P H P SPL+ Sbjct: 3521 TGLNTSSPPSRIFRSPSSLLPATSPSHSPASSPLQ 3625
>LOC_Os05g40870:12005.t03626:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5643 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4097 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 4186
>LOC_Os05g38100:12005.t03352:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5952 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4097 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 4186
>LOC_Os05g37590:12005.t03301:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5623 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 3768 SGPQLPSPSPPPRPARAPRSCLAPPTG*CS 3857
>LOC_Os05g26580:12005.t02313:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3400 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 1740 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 1829
>LOC_Os05g21110:12005.t01872:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3227 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 / -1 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 G PP P ++AP AP PC P P Sbjct: 2006 GPPPPWPPPSAAPPRRAPTPCRAPPAPP 1923
>LOC_Os05g10250:12005.t00860:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6646 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4791 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 4880
>LOC_Os04g56350:12004.t05106:unspliced-genomic nucleolar protein,Nop52 containing protein, expressed| Length = 2010 Score = 31.3 bits (62), Expect = 5.7 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 / -1 Query: 125 STSAPQLPAPRPCHLPVRSP 184 S+S+P P P PCH P SP Sbjct: 1053 SSSSPPSPHPNPCHSPPLSP 994
>LOC_Os04g48094:12004.t04330:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 13573 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 11718 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 11807
>LOC_Os04g43980:12004.t03938:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5962 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4108 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 4197
>LOC_Os04g38080:12004.t03379:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3576 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 1721 SGPQLPSPSPSPRPARAPRICLTPPTG*CS 1810
>LOC_Os04g27890:12004.t02492:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5937 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4082 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 4171
>LOC_Os04g26410:12004.t02348:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2202 Score = 31.3 bits (62), Expect = 5.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 / +1 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 P P+++ PQ PAP P H P +P Sbjct: 316 PPQAPASTPPQDPAPTPPHAPTPTP 390
>LOC_Os04g20350:12004.t01773:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5439 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4109 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 4198
>LOC_Os04g12770:12004.t01100:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3394 Score = 31.3 bits (62), Expect = 5.7 Identities = 20/64 (31%), Positives = 23/64 (35%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNIRNGRADACEES 280 GVP P P PR P R+P L P FG P C+ R A S Sbjct: 2174 GVPCGPPPPWPPPSAAPPRRAPTPRRAPPALPAGPPFGHLTRPAPWCSRRPRPAGGAPRS 1995 Query: 281 NSER 292 +R Sbjct: 1994 VGQR 1983
>LOC_Os04g10410:12004.t00874:unspliced-genomic amidase, putative, expressed| Length = 4685 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 / -2 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 P G + S+P P+P PC P RSP R Sbjct: 805 PLGTGSTPSSPSPPSPPPCSPPRRSPDR 722
>LOC_Os03g59550:12003.t05201:unspliced-genomic RNA-binding protein 8A, putative, expressed| Length = 4840 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 / +1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPW 208 PP ST +P P H VRSP LL W Sbjct: 247 PPTATASTPSPMPATPATAHSAVRSPFVLLFFFW 348
>LOC_Os03g52190:12003.t04545:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5964 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4109 SGPQLPSPSPPPRPARAPRSCLAPPTG*CS 4198
>LOC_Os03g47960:12003.t04158:unspliced-genomic UPL7, putative, expressed| Length = 3019 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 / +2 Query: 95 HRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 H G PP +T+ P PRP P R P R Sbjct: 35 HAGWPPVQRVTTTTPHARRPRPSPSPPRRPCR 130
>LOC_Os03g46220:12003.t03990:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5778 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 3923 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 4012
>LOC_Os03g39930:12003.t03425:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 1961 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 / -2 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 G PP P ++AP AP PC P P Sbjct: 613 GQPPPWPPPSAAPPRRAPTPCRAPPAPP 530
>LOC_Os03g36660:12003.t03135:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4861 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 3006 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 3095
>LOC_Os03g21030:12003.t01859:unspliced-genomic GRAB2 protein, putative, expressed| Length = 2037 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 / -1 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 PA GP+ P P PRP P SP Sbjct: 249 PAAGPAAPPPPSPPPRP*RTPQTSP 175
>LOC_Os02g58620:12002.t05432:unspliced-genomic EMB2758, putative, expressed| Length = 6621 Score = 31.3 bits (62), Expect = 5.7 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 / -2 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLL 199 G PPA P T+ P P PRP PL LL Sbjct: 260 GAPPACRPRTAGPPPPPPRPPSPYFSFPLLFLL 162
>LOC_Os02g52070:12002.t04788:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3137 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 G PP P ++AP AP PC P P Sbjct: 2016 GPPPPWPPPSAAPPRRAPTPCRAPPAPP 1933
>LOC_Os02g48420:12002.t04426:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4897 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4108 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 4197
>LOC_Os02g33470:12002.t02990:unspliced-genomic transposon protein, putative, Pong sub-class| Length = 2171 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 / +1 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLP 172 GL R PA P+T+ P LPA P P Sbjct: 79 GLKRSSAPAPSPATAQPPLPASSPPEAP 162
>LOC_Os02g30130:12002.t02706:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6202 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4347 SGPQLPSPSPSLRPARAPRSCLTPPSG*CS 4436
>LOC_Os02g08470:12002.t00743:unspliced-genomic conserved hypothetical protein| Length = 1127 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLR 190 PP+ PS SAP AP P P P R Sbjct: 1050 PPSPSPSASAPPAAAPTPAPPPAPCPSR 967
>LOC_Os02g04300:12002.t00329:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2298 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 443 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 532
>LOC_Os02g02770:12002.t00176:unspliced-genomic pentatricopeptide, putative, expressed| Length = 2526 Score = 31.3 bits (62), Expect = 5.7 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 / -3 Query: 92 LHRGVPPAGGPSTSAPQLPAP 154 + G PPAG P T +P P P Sbjct: 829 IRTGTPPAGAPETPSPSAPPP 767
>LOC_Os01g63100:12001.t05680:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5624 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 3769 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 3858
>LOC_Os01g55910:12001.t05000:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5027 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 3172 SGPQLPSPSPPPRPARAPRSCLTPPTE*CS 3261
>LOC_Os01g31200:12001.t02704:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2766 Score = 31.3 bits (62), Expect = 5.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 / +2 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 V P GP++S P +P+PRP L P L + CS Sbjct: 2621 VSPWRGPASSRPLVPSPRPWFLRRMEPPALAVRRMRCCS 2737
>LOC_Os01g27800:12001.t02481:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3543 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 G PP P ++AP AP PC P P Sbjct: 2011 GPPPPWPPPSAAPPRRAPTPCRAPPAPP 1928
>LOC_Os01g27790:12001.t02480:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8339 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 6837 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 6926
>LOC_Os01g27650:12001.t02466:unspliced-genomic pentatricopeptide repeat protein PPR986-12, putative| Length = 2208 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 / +2 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPL 187 +PP+ P P+ PAPRP RSPL Sbjct: 362 LPPSPPPPVRPPRPPAPRPTLSLARSPL 445
>LOC_Os01g19410:12001.t01731:unspliced-genomic expressed protein| Length = 2601 Score = 31.3 bits (62), Expect = 5.7 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 98 RGVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLL 196 R P G S S P+LP+P P RSP R L Sbjct: 125 RAAPGRGSISPSPPRLPSPSPACRQRRSPSREL 223
>LOC_Os01g17460:12001.t01590:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5964 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P L P CS Sbjct: 4109 SGPQLPSPSPPPRPARAPRSCLTPPTG*CS 4198
>LOC_Os01g12020:12001.t01071:unspliced-genomic nonspecific lipid-transfer protein precursor, putative, expressed| Length = 2072 Score = 31.3 bits (62), Expect = 5.7 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 / +3 Query: 98 RGVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 R PPA PSTS P+P P P SP Sbjct: 279 RTPPPASPPSTSPAPPPSPPPAASPSASP 365
>LOC_Os01g08410:12001.t00719:unspliced-genomic early fruit mRNA, putative, expressed| Length = 2960 Score = 31.3 bits (62), Expect = 5.7 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 / -2 Query: 164 HLPVRSPLRLLLNPWFGCSEISCPCCNIRNGRADAC 271 HLP R + ++L GC E S PCC++ + +C Sbjct: 2569 HLPHRLLVVMVLLFLLGCREPSAPCCSLSSCNFCSC 2462
>LOC_Os01g05250:12001.t00411:unspliced-genomic expressed protein| Length = 601 Score = 31.3 bits (62), Expect = 5.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 / +2 Query: 95 HRGVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 HR PP+G P+T A +P+ R P+ P Sbjct: 206 HRWRPPSGSPTTLAAAMPSARKSCTPLLHP 295
>LOC_Os09g28240:12009.t02502:unspliced-genomic hypothetical protein| Length = 1178 Score = 26.3 bits (51), Expect(2) = 5.7 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +2 / -1 Query: 215 CSEISCPCCNIRNGRADACEESNSERVRRCCSPA 316 C+ + CP +R+ S + RR SPA Sbjct: 242 CNALRCPRLTLRHSSLPVATSSTAHAPRRSLSPA 141 Score = 22.1 bits (42), Expect(2) = 5.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 / -2 Query: 149 APRPCHLPV 175 AP PCH PV Sbjct: 265 APGPCHQPV 239
>LOC_Os11g35410:12011.t03088:unspliced-genomic expressed protein| Length = 3313 Score = 28.6 bits (56), Expect(2) = 6.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 / -3 Query: 541 PYVCVCFQNFLKPKKLIFDFFFP 473 P+VCV F KP+ ++ D FP Sbjct: 2375 PFVCVIAVKFDKPRGMVPDILFP 2307 Score = 23.5 bits (45), Expect(2) = 6.5 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 / -3 Query: 577 FFFFFDTVSSINPYVCVCF 521 FF + SS+N ++ +CF Sbjct: 3155 FFSIMSSSSSVNNFIMLCF 3099
>LOC_Os03g37010:12003.t03163:unspliced-genomic glycosyltransferase, putative, expressed| Length = 3800 Score = 28.1 bits (55), Expect(2) = 7.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 / +1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRS 181 PPA ++P P P P H P+R+ Sbjct: 199 PPASTSGAASPPPPHPPPLHPPLRA 273 Score = 24.0 bits (46), Expect(2) = 7.3 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 / +3 Query: 227 SCPCCNIRNGRADACEESNSERV 295 S P C+ N RA+ CE R+ Sbjct: 2406 SKPLCDFSNFRANVCEMRGDVRI 2474
>LOC_Os10g22100:12010.t01692:unspliced-genomic expressed protein| Length = 2841 Score = 26.3 bits (51), Expect(2) = 7.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 / +3 Query: 577 FFFFFDTVSSINPYVCV 527 FFFFF ++ +N +VC+ Sbjct: 1767 FFFFFFVLTKLNCFVCL 1817 Score = 25.4 bits (49), Expect(2) = 7.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 / +2 Query: 455 SWSSISNLRCVNIC*LIIHGGVLKKIHRKLKQHKS 351 SWS IS +RC I + G + + H ++ K+ Sbjct: 2477 SWSLISGVRCKKISSTLTMPGTMPRGHHLVQMVKN 2581
>LOC_Os10g39190:12010.t03161:unspliced-genomic RAV, putative| Length = 939 Score = 24.9 bits (48), Expect(2) = 7.9 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 / -3 Query: 98 RGVPPAGGPSTSAPQLPAPRPCHLPVRSP 184 RG P G +++ P P P P R+P Sbjct: 787 RGSPRTAGHASALSSSPPPAPPRWPRRAP 701 Score = 23.1 bits (44), Expect(2) = 7.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 / -3 Query: 52 QQPQGATLSRSDWTTSRGSARG 117 Q P+ + S TTSR +ARG Sbjct: 931 QDPRSTSSSPPSTTTSRTTARG 866
>LOC_Os12g24110:12012.t02140:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6734 Score = 30.9 bits (61), Expect = 7.9 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +2 / +2 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 GL V P GP+ P P+PRP L R P L+ CS Sbjct: 1793 GLSLFVSPWRGPALWRPLAPSPRPWFLRRRKPPALVARRMRCCS 1924
>LOC_Os11g06840:12011.t00576:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 2463 Score = 30.9 bits (61), Expect = 7.9 Identities = 19/53 (35%), Positives = 23/53 (43%) Frame = -1 / -1 Query: 179 IEPVGDKDGERAAVEQTWKVLPRAEPLDVVQSDLDKVAPCGCCSRRVDLHLLD 21 I + D D E AA E W P ++ LDV+ P RR L LLD Sbjct: 558 ITELNDDDAETAAAESPWYPGPISDLLDVLPPPPPSPPPPPPLRRRRPLPLLD 400
>LOC_Os11g01980:12011.t00094:unspliced-genomic conserved hypothetical protein| Length = 809 Score = 30.9 bits (61), Expect = 7.9 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +2 / +1 Query: 119 GPSTSAPQLPAPRPCHLPVRSPLRLL 196 G STSAP+ P P P P RS L L+ Sbjct: 64 GTSTSAPRSPPPAPRGSPTRSALILV 141
>LOC_Os09g27470:12009.t02426:unspliced-genomic conserved hypothetical protein| Length = 2294 Score = 30.9 bits (61), Expect = 7.9 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 / -1 Query: 89 GLHRGVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNP 205 G H V P P T AP LP P P PLR L P Sbjct: 809 GPHLSVVPNLPPPTPAPHLPTPPPFPALSAPPLRPHLAP 693
>LOC_Os09g21890:12009.t01923:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2330 Score = 30.9 bits (61), Expect = 7.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 / -3 Query: 206 WFGCSEISCPCCNIRNGRADACEESNSERVRR 301 W G + PCC+I + AC E +SE R Sbjct: 633 WRGGALAGAPCCHIERRGSAACSECSSEEELR 538
>LOC_Os09g20160:12009.t01750:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2042 Score = 30.9 bits (61), Expect = 7.9 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 / +3 Query: 110 PAGGPSTSAPQLPAPRPCHLPVRSP 184 P+ S S PQ P P P H P SP Sbjct: 222 PSPPASPSPPQAPTPSPPHAPASSP 296
>LOC_Os09g07630:12009.t00559:unspliced-genomic conserved hypothetical protein| Length = 1018 Score = 30.9 bits (61), Expect = 7.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRP 160 PP+ PST +P LP P P Sbjct: 254 PPSAAPSTPSPSLPLPTP 201
>LOC_Os09g03450:12009.t00242:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1532 Score = 30.9 bits (61), Expect = 7.9 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 / +2 Query: 92 LHRGVPPAGGPSTSAPQLPAPR 157 LHRGV P+GGP + LP R Sbjct: 917 LHRGVDPSGGPCSVQRSLPLRR 982
>LOC_Os08g43350:12008.t04060:unspliced-genomic NC domain containing protein, expressed| Length = 2895 Score = 30.9 bits (61), Expect = 7.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 / +2 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLP 172 G PP P+T P + R CHLP Sbjct: 212 GAPPTPTPTTVRPSVDRRRHCHLP 283
>LOC_Os08g37600:12008.t03497:unspliced-genomic 2-oxoglutarate/malate translocator, chloroplast precursor,| putative, expressed Length = 4803 Score = 30.9 bits (61), Expect = 7.9 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 / +2 Query: 98 RGVPPAGGPSTSAPQLPAPRP 160 R +PP GG STS P P P P Sbjct: 98 RHLPPPGGASTSDPPQPLPPP 160
>LOC_Os08g36700:12008.t03409:unspliced-genomic AT-HSFB4, putative, expressed| Length = 1236 Score = 30.9 bits (61), Expect = 7.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 / -3 Query: 113 AGGPSTSAPQLPAPRPCHLPVRSP 184 AGG SAP PA P PVRSP Sbjct: 739 AGGSPASAPPPPASPPRGAPVRSP 668
>LOC_Os08g20610:12008.t01874:unspliced-genomic membrane-associated salt-inducible protein, putative| Length = 2208 Score = 30.9 bits (61), Expect = 7.9 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 / +2 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNP 205 PPA P+TSA P+ P P SP R ++P Sbjct: 191 PPACPPATSARTPPSSTPTASPATSPPRSSISP 289
>LOC_Os07g23310:12007.t02032:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3223 Score = 30.9 bits (61), Expect = 7.9 Identities = 20/64 (31%), Positives = 23/64 (35%) Frame = +2 / -3 Query: 101 GVPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCPCCNIRNGRADACEES 280 GVP P P PR P R+P L P G P C+ R G A S Sbjct: 2015 GVPCGPPPPWLPPSAAPPRRAPTPRRAPSTLPAGPPSGHLARPAPWCSRRLGPAGGAPRS 1836 Query: 281 NSER 292 +R Sbjct: 1835 VGQR 1824
>LOC_Os06g37640:12006.t03459:unspliced-genomic expressed protein| Length = 8785 Score = 30.9 bits (61), Expect = 7.9 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 / -3 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSP 184 P AG PS P LP PRP P + P Sbjct: 467 PRAGSPSRPHPSLPPPRPPPPPWQHP 390
>LOC_Os06g34760:12006.t03173:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6154 Score = 30.9 bits (61), Expect = 7.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 131 SAPQLPAPRPCHLPVRSPLRLLLNPWFGCS 220 S PQLP+P P P R+P + P CS Sbjct: 4299 SGPQLPSPSPFPRPARAPRSCITPPTG*CS 4388
>LOC_Os06g28970:12006.t02601:unspliced-genomic transcription regulator, putative, expressed| Length = 3572 Score = 30.9 bits (61), Expect = 7.9 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 / +1 Query: 107 PPAGGPSTSAPQLPAPRPCHLPVRSP 184 PP GPS P LP+P P P SP Sbjct: 154 PPPVGPSAVTPPLPSPPPPPPPPGSP 231
>LOC_Os06g14470:12006.t01322:unspliced-genomic THO complex subunit 4, putative, expressed| Length = 5069 Score = 30.9 bits (61), Expect = 7.9 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 / -1 Query: 143 LPAPRPCHLPVRSPLRLLLNPWFGCSEIS 229 LP P PC LP+ PL LL S+IS Sbjct: 1184 LPRPPPCDLPLPLPLEFLLFLIISSSDIS 1098
>LOC_Os06g12260:12006.t01103:unspliced-genomic expressed protein| Length = 6537 Score = 30.9 bits (61), Expect = 7.9 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 / +2 Query: 104 VPPAGGPSTSAPQLPAPRPCHLPVRSPLRLLLNPWFGCSEISCP 235 V AGG + ++P PAPR + S R++ P +E S P Sbjct: 827 VGAAGGNADASPAAPAPRSATVADGSAARVISTPAAATAEASTP 958
>LOC_Os05g50680:12005.t04498:unspliced-genomic expressed protein| Length = 1151 Score = 30.9 bits (61), Expect = 7.9 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 / +3 Query: 110 PAGGPSTSAPQLPAPRPCHL 169 P+ P+ AP L APR CHL Sbjct: 348 PSTAPAPPAPALSAPRSCHL 407
>LOC_Os05g49860:12005.t04419:unspliced-genomic histone H2B.2, putative, expressed| Length = 802 Score = 30.9 bits (61), Expect = 7.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 / +1 Query: 110 PAGGPSTSAPQLPAPRPCHLPVR 178 PA PST +P+ P P P P+R Sbjct: 448 PASSPSTPSPRAPRPSPSSPPLR 516
>LOC_Os05g43390:12005.t03830:unspliced-genomic signal recognition particle 54 kDa protein 2, putative, expressed| Length = 3568 Score = 30.9 bits (61), Expect = 7.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +2 / +1 Query: 107 PPAGGPSTSAPQLPAP 154 P +GGPSTS P PAP Sbjct: 415 PTSGGPSTSTPSPPAP 462 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 203,254,649 Number of extensions: 3228103 Number of successful extensions: 30719 Number of sequences better than 10.0: 273 Length of query: 192 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 144 Effective length of database: 52,912,542 Effective search space: 7619406048 Effective search space used: 7619406048 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
