| Clone Name | FLbaf132b21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q3A2E7:TRMD_PELCD tRNA - Pelobacter carbinolicus (strain DSM 238... | 33 | 1.2 | 2 | Q2EEX7:FTSH_HELSJ Cell division protease ftsH homolog - Helicosp... | 32 | 4.6 |
|---|
>Q3A2E7:TRMD_PELCD tRNA - Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)| Length = 247 Score = 33.5 bits (75), Expect = 1.2 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 643 SVFRALVHITDHHLRSWFCRQHHLTHGLPF 732 +V R LV IT HHLR W +H +T +P+ Sbjct: 25 AVKRGLVQITAHHLRDWAEGKHQITDDVPY 54
>Q2EEX7:FTSH_HELSJ Cell division protease ftsH homolog - Helicosporidium sp. subsp.| Simulium jonesii (Green alga) Length = 1460 Score = 31.6 bits (70), Expect = 4.6 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +2 Query: 608 YHQPASTLLFFSPFFVRWFT*LIIISVLGFAGNIISLMVFLFTTVSTLNFTVLH 769 Y+Q + L F+ FFV WF + + S+L F IS+ L ++ + ++H Sbjct: 659 YYQDGNYLKFY--FFVSWFLLIELFSILAFMQIFISIFYILRKSIGEIIIELMH 710 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 158,460,005 Number of extensions: 3426397 Number of successful extensions: 8624 Number of sequences better than 10.0: 2 Number of HSP's gapped: 8616 Number of HSP's successfully gapped: 2 Length of query: 302 Length of database: 100,686,439 Length adjustment: 113 Effective length of query: 189 Effective length of database: 69,691,104 Effective search space: 13171618656 Effective search space used: 13171618656 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)