| Clone Name | FLbaf136l12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q700K0:SSPO_RAT SCO-spondin precursor - Rattus norvegicus (Rat) | 27 | 1.3 | 2 | Q13875:MOBP_HUMAN Myelin-associated oligodendrocyte basic protei... | 33 | 1.6 | 3 | Q8CG65:SSPO_MOUSE SCO-spondin precursor - Mus musculus (Mouse) | 25 | 7.2 |
|---|
>Q700K0:SSPO_RAT SCO-spondin precursor - Rattus norvegicus (Rat)| Length = 5141 Score = 26.6 bits (57), Expect(2) = 1.3 Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 6/33 (18%) Frame = +1 Query: 805 SEWIGCTRP------SG*YVCICLCPHHVWTPC 885 SEW C++P + C+C P H PC Sbjct: 3400 SEWTACSQPCRGQTRTRSRACVCPAPQHGGAPC 3432 Score = 25.4 bits (54), Expect(2) = 1.3 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Frame = +3 Query: 633 NCTCPSG*VEL------VRVDWLYSSEWIGCTRP 716 +CTC G + V DW SEW C++P Sbjct: 3375 HCTCMEGRLNCTDLPCQVSGDWCPWSEWTACSQP 3408
>Q13875:MOBP_HUMAN Myelin-associated oligodendrocyte basic protein - Homo sapiens| (Human) Length = 183 Score = 33.1 bits (74), Expect = 1.6 Identities = 18/34 (52%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -3 Query: 300 VVERPHVPRSAPRTI--PRSVPRSSTERTAPPRS 205 VV P PRS PR+ PRS PRS + +PPRS Sbjct: 90 VVRAPAKPRSPPRSERQPRSPPRSERQPRSPPRS 123
>Q8CG65:SSPO_MOUSE SCO-spondin precursor - Mus musculus (Mouse)| Length = 4998 Score = 25.4 bits (54), Expect(2) = 7.2 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 6/33 (18%) Frame = +1 Query: 805 SEWIGCTRP------SG*YVCICLCPHHVWTPC 885 S+W C++P + C+C P H +PC Sbjct: 3251 SKWTACSQPCRGQTRTRSRACVCPAPQHGGSPC 3283 Score = 23.9 bits (50), Expect(2) = 7.2 Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Frame = +3 Query: 633 NCTCPSG*VEL------VRVDWLYSSEWIGCTRP 716 +CTC G + V DW S+W C++P Sbjct: 3226 HCTCMEGRLNCTDLPCQVSGDWCPWSKWTACSQP 3259 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 183,503,606 Number of extensions: 4343802 Number of successful extensions: 11106 Number of sequences better than 10.0: 3 Number of HSP's gapped: 11067 Number of HSP's successfully gapped: 5 Length of query: 310 Length of database: 100,686,439 Length adjustment: 113 Effective length of query: 197 Effective length of database: 69,691,104 Effective search space: 13729147488 Effective search space used: 13729147488 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)