| Clone Name | FLbaf138l19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q9P6S0:YJP1_SCHPO Uncharacterized threonine-rich protein C1742.0... | 33 | 2.4 | 2 | Q5GH56:XKR7_RAT XK-related protein 7 - Rattus norvegicus (Rat) | 33 | 2.4 | 3 | P22808:VND_DROME Homeobox protein vnd - Drosophila melanogaster ... | 32 | 4.2 | 4 | Q9C615:SYP24_ARATH Putative syntaxin-24 - Arabidopsis thaliana (... | 31 | 9.3 |
|---|
>Q9P6S0:YJP1_SCHPO Uncharacterized threonine-rich protein C1742.01 precursor -| Schizosaccharomyces pombe (Fission yeast) Length = 1563 Score = 33.1 bits (74), Expect = 2.4 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -1 Query: 647 PSTRTVSST*PAVSSCASATARYGASG--TFDPTRNGDHTETSRWPWYTTGSAVG 489 P+T TVSST SS ++ Y SG T+ R + + T + +YTTG G Sbjct: 1473 PATETVSSTEAPESSTVTSNPIYQGSGTSTWSTVRQWNGSATYNYTYYTTGGFTG 1527
>Q5GH56:XKR7_RAT XK-related protein 7 - Rattus norvegicus (Rat)| Length = 580 Score = 33.1 bits (74), Expect = 2.4 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -3 Query: 732 SVDGEQSGAPDPEVVVPRDERPGLPPDPAVHPHREQ 625 +V GE++G P P V RPGLPP P P R + Sbjct: 488 AVGGERAGTPTPPVF---QVRPGLPPTPVARPLRTE 520
>P22808:VND_DROME Homeobox protein vnd - Drosophila melanogaster (Fruit fly)| Length = 723 Score = 32.3 bits (72), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 1184 QQEGPRREDHHLPLLYQKQQHRNNAHAPTP 1095 QQ+ P + HH P L QQH A AP P Sbjct: 295 QQQHPHHQQHHHPHLLLPQQHHQQAVAPLP 324
>Q9C615:SYP24_ARATH Putative syntaxin-24 - Arabidopsis thaliana (Mouse-ear cress)| Length = 416 Score = 31.2 bits (69), Expect = 9.3 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 1/70 (1%) Frame = +1 Query: 313 RFYLNDLTVACLNATSNPASYLTVTLQATIAARNPNTRVGIYFDRTDAYAEYKGQQV-TV 489 +F + D + + SN + L +L ++ RN + +GI++DR +A Y Q++ V Sbjct: 8 KFQVYDAELTHFDLESN--NNLQYSLSLNLSIRNSKSSIGIHYDRFEATVYYMNQRLGAV 65 Query: 490 PTALPVVYQG 519 P +P+ Y G Sbjct: 66 P--MPLFYLG 73 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 157,427,715 Number of extensions: 2973735 Number of successful extensions: 7842 Number of sequences better than 10.0: 4 Number of HSP's gapped: 7820 Number of HSP's successfully gapped: 4 Length of query: 412 Length of database: 100,686,439 Length adjustment: 116 Effective length of query: 296 Effective length of database: 68,868,219 Effective search space: 20384992824 Effective search space used: 20384992824 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)