ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf130d24 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os07g37240:12007.t03393:unspliced-genomic expressed protein| Length = 1669 Score = 63.4 bits (132), Expect = 5e-10 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 / +2 Query: 3 KGPLNNWATHLSDPLHTTIFDTF 71 KGPLNNWATHLSDPLHTTIFDTF Sbjct: 1223 KGPLNNWATHLSDPLHTTIFDTF 1291 Score = 48.7 bits (100), Expect(2) = 6e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 / -2 Query: 70 KVSKMVVCSGSLRWVAQLLSGPL 2 KVSKMVV SGSLRWVAQLL GPL Sbjct: 1290 KVSKMVVWSGSLRWVAQLLRGPL 1222 Score = 24.4 bits (47), Expect(2) = 6e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 / -2 Query: 308 DVQVDALSHH 279 DVQVDAL HH Sbjct: 1545 DVQVDALIHH 1516 Score = 48.3 bits (99), Expect(2) = 2e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -3 / -1 Query: 71 EGVEDGGVQRVAEVGGPVVERTL 3 EGVEDGGV+RVAEVGGPVVE L Sbjct: 1291 EGVEDGGVERVAEVGGPVVEGPL 1223 Score = 23.1 bits (44), Expect(2) = 2e-06 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 / -3 Query: 307 MYKWMH*VTI 278 MYKWMH* I Sbjct: 1544 MYKWMH*FII 1515 Score = 50.1 bits (103), Expect = 5e-06 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +1 / +3 Query: 1 ARVRSTTGPPTSATRCTPPSSTPS 72 AR STTGPPTSATR TPPSSTPS Sbjct: 1221 ARGPSTTGPPTSATRSTPPSSTPS 1292
>LOC_Os12g06210:12012.t00507:unspliced-genomic harpin-induced protein, putative| Length = 675 Score = 38.2 bits (77), Expect = 0.021 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S+TGPPTS T PPS+ PS P Sbjct: 83 SSTGPPTSPTASAPPSNPPSCP 148
>LOC_Os08g40940:12008.t03824:unspliced-genomic expressed protein| Length = 1285 Score = 27.6 bits (54), Expect(2) = 0.039 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +3 / +1 Query: 204 PLLIIMLVRSHRRAAG 251 PL +++L R HRRAAG Sbjct: 643 PLFLLLLRRRHRRAAG 690 Score = 27.2 bits (53), Expect(2) = 0.039 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 / +3 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S T PP++ + P SSTPS P Sbjct: 588 SPTPPPSAPSTRPPSSSTPSLP 653
>LOC_Os09g12540:12009.t01044:unspliced-genomic chlorophyll a-b binding protein, chloroplast precursor, putative,| expressed Length = 2929 Score = 37.3 bits (75), Expect = 0.039 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 / +1 Query: 3 KGPLNNWATHLSDPLHTTIFDTF 71 KGP+ N HLSDPLH I +F Sbjct: 2614 KGPIQNLVEHLSDPLHNNILSSF 2682
>LOC_Os09g09460:12009.t00738:unspliced-genomic NHL25, putative| Length = 1469 Score = 36.3 bits (73), Expect = 0.075 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 / +3 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAPLKWSVVEQFLSAQLQNG 129 R T P +A C PP + LKW V ++ SA+ NG Sbjct: 1242 RAHRTGEPRAAAAACQPPVHATAKWLKWEVEDELASAEQDNG 1367
>LOC_Os02g06490:12002.t00547:unspliced-genomic vacuolar protein sorting-associated protein VPS4, putative,| expressed Length = 3660 Score = 35.9 bits (72), Expect = 0.10 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = +1 / +1 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 RSTT P TS+T TP S+TPS P Sbjct: 175 RSTTSPRTSSTSGTPGSATPSLP 243
>LOC_Os01g06660:12001.t00549:unspliced-genomic pyruvate decarboxylase isozyme 1, putative, expressed| Length = 4114 Score = 28.6 bits (56), Expect(2) = 0.11 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 / +1 Query: 16 TTGPPTSATRCTPPSSTPS 72 ++G TS+TR TPP+ TP+ Sbjct: 340 SSGAATSSTRRTPPTGTPA 396 Score = 27.6 bits (54), Expect(2) = 0.11 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +1 / +2 Query: 52 PPSSTPSAPLKWSVVEQFLSAQLQNGRTRVRVTNVLWF 165 PP S P PL+ +V+ Q + L + T WF Sbjct: 2672 PPLSEPGEPLRVNVLFQHIQKMLSANSAVIAETGDSWF 2785
>LOC_Os11g02070:12011.t00102:unspliced-genomic TD and POZ domain-containing protein 2, putative, expressed| Length = 1916 Score = 35.4 bits (71), Expect = 0.14 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 / -1 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAPLK 84 R S PP SA RC PP P+AP K Sbjct: 1607 RSSSAPPPPASAARCPPPPPPPAAPRK 1527
>LOC_Os11g02054:12011.t00100:unspliced-genomic expressed protein| Length = 6937 Score = 35.4 bits (71), Expect = 0.14 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 / +1 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAPLK 84 R S PP SA RC PP P+AP K Sbjct: 6643 RSSSAPPPPASAARCPPPPPPPAAPRK 6723
>LOC_Os05g48900:12005.t04324:unspliced-genomic fasciclin-like arabinogalactan protein 7 precursor, putative,| expressed Length = 1188 Score = 35.4 bits (71), Expect = 0.14 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 / +3 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R ++T PP S RC+PPSS ++P Sbjct: 543 RTTTSTSPPASTGRCSPPSSARTSP 617
>LOC_Os01g15270:12001.t01378:unspliced-genomic expressed protein| Length = 873 Score = 35.4 bits (71), Expect = 0.14 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 / +3 Query: 10 RSTTGPPTSATRCTPPSSTP 69 R+TTGPPTS TPP+S P Sbjct: 330 RATTGPPTSPAAPTPPTSAP 389 Score = 30.9 bits (61), Expect = 3.3 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 / -3 Query: 68 GVEDGGVQRVAEVGGPVVER 9 G E GGV EVGGPVV R Sbjct: 388 GAEVGGVGAAGEVGGPVVAR 329
>LOC_Os08g33820:12008.t03123:unspliced-genomic chlorophyll a-b binding protein 4, chloroplast precursor, putative,| expressed Length = 1452 Score = 35.0 bits (70), Expect = 0.19 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 3 KGPLNNWATHLSDPLHTTIFDT 68 KGP +N HLSDP H TI T Sbjct: 938 KGPFDNLLQHLSDPWHNTIIQT 1003
>LOC_Os06g14710:12006.t01346:unspliced-genomic myb-like DNA-binding domain containing protein| Length = 429 Score = 35.0 bits (70), Expect = 0.19 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +1 / +2 Query: 16 TTGPPTSATRCTPPSSTPSAP 78 TT P TS+T +PP++TPS+P Sbjct: 248 TTSPATSSTALSPPTTTPSSP 310
>LOC_Os10g35050:12010.t02800:unspliced-genomic aquaporin TIP3.1, putative, expressed| Length = 1430 Score = 34.5 bits (69), Expect = 0.27 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 / +1 Query: 13 STTGPPTSATRCTPPSSTPSAPLKWSV 93 S+TG P+S+ +PPSS+ S P W V Sbjct: 604 SSTGSPSSSAPSSPPSSSASPPAAWYV 684
>LOC_Os04g30730:12004.t05483:unspliced-genomic 60S ribosomal protein L35, putative, expressed| Length = 2010 Score = 34.5 bits (69), Expect = 0.27 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +1 / +2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAPL 81 A RS PPTS+ RC PPSS A L Sbjct: 302 ASPRSPAAPPTSSPRCAPPSSFSLARL 382
>LOC_Os01g61550:12001.t05534:unspliced-genomic ammonium transporter 2, putative, expressed| Length = 1927 Score = 34.5 bits (69), Expect = 0.27 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 / -2 Query: 19 TGPPTSATRCTPPSSTPSAP 78 T PP +ATRC P S+TP+ P Sbjct: 165 TSPPPAATRCRPCSATPAPP 106
>LOC_Os06g21590:12006.t01976:unspliced-genomic chlorophyll a-b binding protein 6A, chloroplast precursor, putative,| expressed Length = 1530 Score = 34.1 bits (68), Expect = 0.36 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 6 GPLNNWATHLSDPLHTTIFD 65 GPL N A+HLSDP H I D Sbjct: 1058 GPLENLASHLSDPWHNNIGD 1117 Score = 32.2 bits (64), Expect = 1.3 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = -1 / -1 Query: 67 VSKMVVCSGSLRWVAQLLSGPL 2 +S M++C GS RW+A+ SGP+ Sbjct: 1119 MSPMLLCHGSERWLARFSSGPV 1054
>LOC_Os12g02030:12012.t00100:unspliced-genomic TD and POZ domain-containing protein 2, putative, expressed| Length = 1877 Score = 34.1 bits (68), Expect = 0.37 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 / -2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R S PP SA RC PP P+AP Sbjct: 1582 RSSSAPPPPASAARCPPPPPPPAAP 1508
>LOC_Os10g39140:12010.t03156:unspliced-genomic gibberellin 20 oxidase 2, putative, expressed| Length = 5866 Score = 34.1 bits (68), Expect = 0.37 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +1 / +1 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S+T PP +A +PPS+TP+AP Sbjct: 304 SSTSPPPTAPPSSPPSATPAAP 369
>LOC_Os10g38780:12010.t03118:unspliced-genomic glutathione S-transferase GSTU6, putative, expressed| Length = 1222 Score = 34.1 bits (68), Expect = 0.37 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 +++ PPT +TR +P SSTP+AP Sbjct: 374 TSSSPPTRSTRPSPSSSTPAAP 439
>LOC_Os09g26340:12009.t02313:unspliced-genomic histone H4, putative, expressed| Length = 1022 Score = 34.1 bits (68), Expect = 0.37 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +1 / -2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAPLKWSVVEQFLSAQLQNGRTRVR 144 A R+T SA+ C S+TP + L+ S V + L NGRT ++ Sbjct: 760 ATARATGTSTPSASSCGCWSATPGSALRCSTVRRSSQPSLSNGRTELQ 617
>LOC_Os09g25460:12009.t02225:unspliced-genomic anthranilate N-benzoyltransferase protein 1, putative, expressed| Length = 4440 Score = 34.1 bits (68), Expect = 0.37 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 / +3 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R S+ GP + ATRC+P SS P P Sbjct: 384 RCSSSPGPTSPATRCSPTSSPPPRP 458
>LOC_Os08g16260:12008.t01500:unspliced-genomic cytochrome P450 86A1, putative, expressed| Length = 1697 Score = 34.1 bits (68), Expect = 0.37 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +1 / +3 Query: 16 TTGPPTSATRCTPPSSTPSAPLKWS 90 T PPTS TR T S TPS+ WS Sbjct: 873 TFSPPTSTTRTTSASCTPSSSPTWS 947
>LOC_Os05g04640:12005.t00358:unspliced-genomic OsWRKY5 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 5421 Score = 34.1 bits (68), Expect = 0.37 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPS 72 S+ PP++ATRC+PP++T S Sbjct: 4889 SSPAPPSAATRCSPPTTTSS 4948
>LOC_Os04g35770:12004.t03247:unspliced-genomic pectinesterase-2 precursor, putative, expressed| Length = 1844 Score = 34.1 bits (68), Expect = 0.37 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 RST+ PP S+T T P+S+PS P Sbjct: 359 RSTSPPPRSSTSTTAPTSSPSRP 427
>LOC_Os01g63400:12001.t05709:unspliced-genomic rf1 protein, mitochondrial precursor, putative, expressed| Length = 4568 Score = 34.1 bits (68), Expect = 0.37 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 / +3 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 RS++ PP+ A C P STPSAP Sbjct: 291 RSSSYPPSPAPSCPTPRSTPSAP 359
>LOC_Os06g02680:12006.t00161:unspliced-genomic expressed protein| Length = 2441 Score = 31.3 bits (62), Expect(2) = 0.43 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPS 72 R RS + PP S +PPSS+PS Sbjct: 98 RTRSPSSPPPSPCSSSPPSSSPS 166 Score = 22.1 bits (42), Expect(2) = 0.43 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 / +3 Query: 136 RVRVTNVLWFC 168 RV+ +VLWFC Sbjct: 1488 RVKQYSVLWFC 1520
>LOC_Os12g01990:12012.t00097:unspliced-genomic expressed protein| Length = 1520 Score = 33.6 bits (67), Expect = 0.50 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 / +2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAPLKW 87 +R+ ST PP + T PPS+T SA W Sbjct: 845 SRITSTPRPPPARTTTPPPSTTASARSSW 931
>LOC_Os08g15460:12008.t01420:unspliced-genomic preprotein translocase secY subunit, chloroplast precursor, putative,| expressed Length = 9138 Score = 33.6 bits (67), Expect = 0.50 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 / -2 Query: 318 FFF*CTSGCIESPLVHILQITKSQQLSYVIGP 223 +FF C C++S ++ LQ + LSY IGP Sbjct: 8372 YFFLCAGSCLDSHAIYQLQAYQCPFLSYNIGP 8277
>LOC_Os07g40510:12007.t03709:unspliced-genomic formin-2, putative, expressed| Length = 6892 Score = 33.6 bits (67), Expect = 0.50 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 / +2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAPLKWS 90 +R S + ++ +RC+P SST S P +WS Sbjct: 557 SRCTSRSSTSSTTSRCSPRSSTTSTPSRWS 646
>LOC_Os07g31884:12007.t02873:unspliced-genomic transparent testa 12 protein, putative, expressed| Length = 6914 Score = 33.6 bits (67), Expect = 0.50 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 / +1 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLKWS 90 R T PP + +PPSS+P P WS Sbjct: 5239 RGTASPPRRSGSSSPPSSSPRPPPSWS 5319
>LOC_Os03g10890:12003.t00890:unspliced-genomic RING-H2 finger protein, putative, expressed| Length = 2195 Score = 33.6 bits (67), Expect = 0.50 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 / +3 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAPLK 84 AR S+T P TSA+ CTP P+A L+ Sbjct: 450 ARAASSTPPGTSASTCTPGPRPPAAALR 533
>LOC_Os02g48770:12002.t04461:unspliced-genomic jasmonate O-methyltransferase, putative, expressed| Length = 2173 Score = 33.6 bits (67), Expect = 0.50 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAPLKWSV 93 STT P T++T C+ PSS + +WS+ Sbjct: 725 STTSPATTSTSCSSPSSCSRSSPRWSL 805
>LOC_Os02g42530:12002.t03838:unspliced-genomic expressed protein| Length = 5735 Score = 33.6 bits (67), Expect = 0.50 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 / +3 Query: 16 TTGPPTSATRCTPPSSTPSAP 78 T P T A+R +PPS TPS+P Sbjct: 333 TASPATGASRSSPPSPTPSSP 395
>LOC_Os01g11200:12001.t00992:unspliced-genomic transforming protein myb, putative| Length = 2526 Score = 33.6 bits (67), Expect = 0.50 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +1 / +2 Query: 16 TTGPPTSATRCTPPSSTPSAP 78 TT P TS T +PP++TPS+P Sbjct: 2174 TTSPATSTTAPSPPTTTPSSP 2236
>LOC_Os01g04840:12001.t00371:unspliced-genomic vacuolar sorting protein 4b, putative| Length = 3527 Score = 33.6 bits (67), Expect = 0.50 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S+T PTS+TR TP S TPS P Sbjct: 107 SSTSRPTSSTRRTPRSRTPSPP 172
>LOC_Os11g07470:12011.t00638:unspliced-genomic expressed protein| Length = 7076 Score = 33.1 bits (66), Expect = 0.69 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 / +2 Query: 25 PPTSATRCTPPSSTPSAP 78 PPTS+TRC P S P++P Sbjct: 308 PPTSSTRCCSPPSPPTSP 361
>LOC_Os09g26350:12009.t02314:unspliced-genomic expressed protein| Length = 997 Score = 33.1 bits (66), Expect = 0.69 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +1 / +3 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAPLKWSVVEQFLSAQLQNGRT 135 A R+T SA+ C S+TP + L+ S V + L NGRT Sbjct: 861 ATARATGTSTPSASSCGCWSATPGSALRCSTVRRSSQPSLSNGRT 995
>LOC_Os06g42020:12006.t03894:unspliced-genomic CSLA9 - cellulose synthase-like family A, expressed| Length = 4685 Score = 33.1 bits (66), Expect = 0.69 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 / -3 Query: 10 RSTTGPPTSATRCTPPSSTPSAPL 81 R+ + PP S T CTPP+ +P+ L Sbjct: 1473 RTLSSPPCSPTSCTPPAPSPAVAL 1402 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 / +3 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAPLKWS 90 A +T P + T TP S TP+ P WS Sbjct: 306 AATGATPSSPPAPTMTTPSSPTPTPPSPWS 395
>LOC_Os06g14010:12006.t01276:unspliced-genomic MYB transcription factor TaMYB1, putative| Length = 510 Score = 33.1 bits (66), Expect = 0.69 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +1 / +2 Query: 16 TTGPPTSATRCTPPSSTPSAP 78 TT P TS+T +PP +TPS+P Sbjct: 236 TTSPATSSTAPSPPPTTPSSP 298
>LOC_Os05g40630:12005.t03602:unspliced-genomic expressed protein| Length = 1041 Score = 33.1 bits (66), Expect = 0.69 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 / -1 Query: 25 PPTSATRCTPPSSTPSAP 78 PP+S++RC PP S P AP Sbjct: 177 PPSSSSRCPPPPSPPVAP 124
>LOC_Os02g02190:12002.t00119:unspliced-genomic high affinity nitrate transporter, putative, expressed| Length = 1860 Score = 33.1 bits (66), Expect = 0.69 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +1 / +3 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 ST+ PTSAT +PPS PS+P Sbjct: 372 STSPRPTSATPASPPSPAPSSP 437
>LOC_Os02g02170:12002.t00117:unspliced-genomic high affinity nitrate transporter, putative, expressed| Length = 1922 Score = 33.1 bits (66), Expect = 0.69 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 ST+ PTSAT +PPS PS+P Sbjct: 377 STSPRPTSATPASPPSPAPSSP 442
>LOC_Os01g70090:12001.t06310:unspliced-genomic delta3,5-delta2,4-dienoyl-CoA isomerase, mitochondrial precursor,| putative, expressed Length = 2900 Score = 33.1 bits (66), Expect = 0.69 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 / +1 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 RS+T PP A C+PP + SAP Sbjct: 238 RSSTAPPPRAPSCSPPPARTSAP 306
>LOC_Os11g43640:12011.t03894:unspliced-genomic extensin-like protein, putative| Length = 2882 Score = 32.7 bits (65), Expect = 0.95 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPSSTP 69 R+TT PT+A+ TPPS+TP Sbjct: 335 RATTCAPTTASSATPPSTTP 394
>LOC_Os11g42960:12011.t03826:unspliced-genomic plant integral membrane protein TIGR01569 containing protein,| expressed Length = 1314 Score = 32.7 bits (65), Expect = 0.95 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 / +1 Query: 25 PPTSATRCTPPSSTPSAP 78 P TSATRCT P ++PS P Sbjct: 667 PATSATRCTLPCTSPSPP 720
>LOC_Os10g42550:12010.t03480:unspliced-genomic inositol-tetrakisphosphate 1-kinase 1, putative, expressed| Length = 1718 Score = 32.7 bits (65), Expect = 0.95 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R STT PP+ +PPS++PS+P Sbjct: 515 RSSSTTPPPSPTPASSPPSASPSSP 589
>LOC_Os10g28230:12010.t02177:unspliced-genomic histone H2A variant 2, putative, expressed| Length = 1375 Score = 32.7 bits (65), Expect = 0.95 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 / -1 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R R GPP S TR +PP + P +P Sbjct: 835 RCRRAPGPPPSGTRGSPPCTPPPSP 761
>LOC_Os02g45000:12002.t04090:unspliced-genomic expressed protein| Length = 1619 Score = 32.7 bits (65), Expect = 0.95 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLKWS 90 RS + PPTS R + PS PSAP + S Sbjct: 434 RSPSTPPTSPRRSSTPSPAPSAPSRRS 514
>LOC_Os03g51330:12003.t04463:unspliced-genomic DELLA protein SLR1, putative, expressed| Length = 2547 Score = 25.4 bits (49), Expect(2) = 1.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPS 60 RSTT PT ++R +PP+ Sbjct: 1124 RSTTPAPTPSSRTSPPT 1174 Score = 24.4 bits (47), Expect(2) = 1.0 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = +1 / +1 Query: 79 LKWSVVEQFLSAQLQNGRTRVRVTNV 156 ++W+ + Q L+ + + TR+R+T V Sbjct: 1243 IQWAALLQALATRPEGKPTRIRITGV 1320 Score = 31.8 bits (63), Expect = 1.8 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +1 / -3 Query: 1 ARVRSTTGPPTSATRCTPPSS 63 AR RS T P SATRC PSS Sbjct: 1858 ARARSRTTPSGSATRCCRPSS 1796
>LOC_Os06g02850:12006.t00178:unspliced-genomic expressed protein| Length = 2698 Score = 29.9 bits (59), Expect(2) = 1.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPS 72 R RST+ PP S +P SS+PS Sbjct: 224 RTRSTSSPPPSPCSSSPRSSSPS 292 Score = 22.1 bits (42), Expect(2) = 1.1 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 / +1 Query: 136 RVRVTNVLWFC 168 RV+ +VLWFC Sbjct: 1627 RVKQYSVLWFC 1659
>LOC_Os08g31700:12008.t04360:unspliced-genomic carbohydrate transporter/ sugar porter/ transporter, putative,| expressed Length = 2002 Score = 32.2 bits (64), Expect = 1.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 / +2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAP 78 +R R T PPT T P+S+PSAP Sbjct: 173 SRRRRTRSPPTPPRATTAPASSPSAP 250
>LOC_Os06g19110:12006.t01734:unspliced-genomic cadmium tolerance factor, putative, expressed| Length = 3336 Score = 32.2 bits (64), Expect = 1.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 / +3 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAPLKW 87 R R+ TGPP + C+ PSS+ ++ +W Sbjct: 450 RGRAGTGPPPRSPSCSSPSSSSTSRCRW 533
>LOC_Os04g39980:12004.t03563:unspliced-genomic gibberellin 20 oxidase 2, putative, expressed| Length = 2107 Score = 32.2 bits (64), Expect = 1.3 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 / +1 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAP 78 A+ +T P SAT PP+STPSAP Sbjct: 646 AQPTRSTRPSASATPPPPPTSTPSAP 723
>LOC_Os03g36684:12003.t03137:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5964 Score = 32.2 bits (64), Expect = 1.3 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -2 / -2 Query: 282 PLVHILQITKSQQLSYVIGPAL*STKDLCDTLSSITRHTKPK 157 P+V+ L T + V G +L* + DLC TL S+ PK Sbjct: 3665 PMVYFLPFTINSNSGAVPGVSL*KSGDLCRTLISLREPGNPK 3540
>LOC_Os02g52730:12002.t04853:unspliced-genomic ferredoxin--nitrite reductase, chloroplast precursor, putative,| expressed Length = 3309 Score = 32.2 bits (64), Expect = 1.3 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 / -2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S + PP + TR +PP+++P+AP Sbjct: 2837 SASAPPGAPTRASPPATSPAAP 2772
>LOC_Os01g65720:12001.t05934:unspliced-genomic glycosyl hydrolase, family 43 protein, expressed| Length = 2967 Score = 32.2 bits (64), Expect = 1.3 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 / +1 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 R+ PP AT TPP+S+P AP Sbjct: 76 RTPQPPPVDATSATPPTSSPWAP 144
>LOC_Os01g25484:12001.t02264:unspliced-genomic ferredoxin--nitrite reductase, chloroplast precursor, putative,| expressed Length = 6554 Score = 32.2 bits (64), Expect = 1.3 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 / -2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S + PP + TR +PP+++P+AP Sbjct: 6091 SASAPPGAPTRASPPATSPAAP 6026
>LOC_Os01g01940:12001.t00089:unspliced-genomic expressed protein| Length = 1408 Score = 32.2 bits (64), Expect = 1.3 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 / +3 Query: 16 TTGPPTSATRCTPPSSTP 69 TT PP SA+RC P+ TP Sbjct: 345 TTSPPCSASRCATPTPTP 398
>LOC_Os07g38960:12007.t03559:unspliced-genomic chlorophyll a-b binding protein, chloroplast precursor, putative,| expressed Length = 2011 Score = 31.8 bits (63), Expect = 1.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 / +3 Query: 6 GPLNNWATHLSDPLHTTIF 62 GP++N HL+DP H TIF Sbjct: 1152 GPIDNLFAHLADPGHATIF 1208
>LOC_Os12g31610:12012.t02865:unspliced-genomic lectin-like protein kinase, putative| Length = 3332 Score = 31.8 bits (63), Expect = 1.8 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 / -2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAP 78 +R R++ PP + RCTP ++ P+ P Sbjct: 250 SRRRTSPSPPPARRRCTPTAAAPTTP 173
>LOC_Os12g29330:12012.t02642:unspliced-genomic NAC domain-containing protein 71, putative, expressed| Length = 1381 Score = 31.8 bits (63), Expect = 1.8 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAPLKWSVVEQFLSAQLQNGRTRVR 144 R R PP + T TPP S P+ P + S A + G R R Sbjct: 734 RPRRQPAPPPTPTTTTPPRSAPTTPRRASGSSTSSPAPTRGGAARRR 874
>LOC_Os09g37520:12009.t03226:unspliced-genomic expressed protein| Length = 5975 Score = 31.8 bits (63), Expect = 1.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 / +1 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 R+TT PP +R TPPS P P Sbjct: 691 RATTSPPPPPSRPTPPSPPPPPP 759
>LOC_Os08g41690:12008.t03898:unspliced-genomic expressed protein| Length = 3083 Score = 31.8 bits (63), Expect = 1.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 / +3 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAPLKWS 90 R T+ PP S TRC+P S ++P + S Sbjct: 306 RTSPTSSPPPSRTRCSPSSPGSASPARTS 392
>LOC_Os08g12990:12008.t01177:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 10657 Score = 31.8 bits (63), Expect = 1.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 / +2 Query: 16 TTGPPTSATRCTPPSSTPSAP 78 TT P +A R TPP++TP AP Sbjct: 287 TTPPSRAAPRRTPPATTPGAP 349
>LOC_Os08g02220:12008.t00117:unspliced-genomic endoglucanase 1 precursor, putative, expressed| Length = 1911 Score = 31.8 bits (63), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 / -1 Query: 16 TTGPPTSATRCTPPSSTPSAP 78 TT PP S+ C+PP+++P P Sbjct: 1443 TTSPPGSSPGCSPPAASPPPP 1381
>LOC_Os07g44200:12007.t04061:unspliced-genomic transcription regulator, putative, expressed| Length = 1643 Score = 31.8 bits (63), Expect = 1.8 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +1 / +3 Query: 28 PTSATRCTPPSSTPSAP 78 PT+AT TPPSSTP P Sbjct: 180 PTTATSPTPPSSTPPTP 230
>LOC_Os07g06880:12007.t00567:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1559 Score = 31.8 bits (63), Expect = 1.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSST 66 ST GPP AT CTP SS+ Sbjct: 1106 STPGPPPPATSCTPSSSS 1159
>LOC_Os06g50140:12006.t04698:unspliced-genomic endoglucanase 1 precursor, putative, expressed| Length = 2593 Score = 31.8 bits (63), Expect = 1.8 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 / +1 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R STT P T+AT TPP+ T ++P Sbjct: 1255 RAGSTTPPATTATSPTPPARTRTSP 1329
>LOC_Os06g14490:12006.t01324:unspliced-genomic calmodulin-binding heat-shock protein, putative, expressed| Length = 4486 Score = 31.8 bits (63), Expect = 1.8 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 / +3 Query: 1 ARVRSTTGPPTSATRCTPPSSTPS 72 AR +T PP A R T PSSTP+ Sbjct: 858 ARYGATRSPPPGACRSTSPSSTPT 929
>LOC_Os05g33760:12005.t02971:unspliced-genomic pentatricopeptide repeat, putative, expressed| Length = 5364 Score = 31.8 bits (63), Expect = 1.8 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 / +2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAP 78 +R RS+ P + TRC P SST S P Sbjct: 227 SRPRSSRSPAWTRTRCPPSSSTTSRP 304
>LOC_Os05g04380:12005.t00334:unspliced-genomic peroxidase 1 precursor, putative, expressed| Length = 4974 Score = 31.8 bits (63), Expect = 1.8 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 / +1 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 R+ + P TSATR PPS PS P Sbjct: 4066 RTRSCPTTSATRTPPPSPPPSRP 4134
>LOC_Os04g57800:12004.t05246:unspliced-genomic photoreceptor-interacting protein-like, putative, expressed| Length = 4384 Score = 31.8 bits (63), Expect = 1.8 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 / -3 Query: 25 PPTSATRCTPPSSTPSAP 78 PPTSAT CT S++P++P Sbjct: 971 PPTSATPCTAVSASPASP 918
>LOC_Os04g34740:12004.t03150:unspliced-genomic hypothetical protein| Length = 1697 Score = 31.8 bits (63), Expect = 1.8 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 / +1 Query: 28 PTSATRCTPPSSTPSAPLKWSVV 96 PT TRC S+T S P WSVV Sbjct: 1291 PTCVTRCGRSSATTSPPTWWSVV 1359
>LOC_Os03g30870:12003.t02693:unspliced-genomic progesterone 5-beta-reductase, putative| Length = 1007 Score = 31.8 bits (63), Expect = 1.8 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 / -2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S T PP S + C+PP TP+ P Sbjct: 787 SLTMPPPSGSPCSPPPRTPTTP 722
>LOC_Os03g25304:12003.t02222:unspliced-genomic myb-like DNA-binding domain containing protein, expressed| Length = 534 Score = 31.8 bits (63), Expect = 1.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 +TT P T T +PP++TPS+P Sbjct: 293 ATTSPATCTTAPSPPTTTPSSP 358
>LOC_Os03g22170:12003.t01969:unspliced-genomic ethylene-responsive factor-like protein 1, putative, expressed| Length = 1255 Score = 31.8 bits (63), Expect = 1.8 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 / +1 Query: 4 RVRSTTGPPTSATRCTPPSST 66 R R TT PPT+AT PP+ST Sbjct: 628 RRRRTTSPPTTATPPPPPTST 690
>LOC_Os03g03720:12003.t00254:unspliced-genomic glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor,| putative, expressed Length = 3403 Score = 31.8 bits (63), Expect = 1.8 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 / +2 Query: 25 PPTSATRCTPPSSTPSAPLKWS 90 P TSA +PP STP +P W+ Sbjct: 2687 PSTSAAPTSPPPSTPRSPWSWA 2752
>LOC_Os02g49870:12002.t04571:unspliced-genomic expressed protein| Length = 2484 Score = 31.8 bits (63), Expect = 1.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 / +2 Query: 16 TTGPPTSATRCTPPSSTPSAPLKWSV 93 T P+S + C P SS PS P W V Sbjct: 461 TPAAPSSPSGCRPSSSAPSTPCLWFV 538
>LOC_Os02g36450:12002.t03282:unspliced-genomic sugar transport protein 5, putative, expressed| Length = 4359 Score = 31.8 bits (63), Expect = 1.8 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 / +1 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLKWS 90 RS T +S RC+ PSS PS WS Sbjct: 2662 RSRTRTASSTARCSTPSSPPSTSPPWS 2742
>LOC_Os02g36440:12002.t03281:unspliced-genomic sugar transport protein 5, putative, expressed| Length = 4628 Score = 31.8 bits (63), Expect = 1.8 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 / +1 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLKWS 90 RS T +S RC+ PSS PS WS Sbjct: 2773 RSRTRTASSTARCSTPSSPPSTSPPWS 2853
>LOC_Os02g30690:12002.t02762:unspliced-genomic steroleosin, putative| Length = 1386 Score = 31.8 bits (63), Expect = 1.8 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R R++ PP SA R T SSTP++P Sbjct: 71 RSRASPRPPASAARRTSSSSTPTSP 145
>LOC_Os02g06670:12002.t00565:unspliced-genomic early nodulin 20 precursor, putative, expressed| Length = 1259 Score = 31.8 bits (63), Expect = 1.8 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 / +3 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 ST PPTS +PP S+PS P Sbjct: 915 STAPPPTSPAPASPPPSSPSPP 980
>LOC_Os02g02740:12002.t00173:unspliced-genomic ATP binding protein, putative, expressed| Length = 2854 Score = 31.8 bits (63), Expect = 1.8 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPS 72 S+ PT+A+R TPPS+TPS Sbjct: 542 SSPSSPTTASRPTPPSTTPS 601
>LOC_Os06g20210:12006.t01838:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 7554 Score = 29.9 bits (59), Expect(2) = 2.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 / -3 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLKWSVV 96 + TT P + CT P+STP +P + +V+ Sbjct: 4201 KKTTDKPITQRSCTNPTSTPVSPHRGTVL 4115 Score = 22.6 bits (43), Expect(2) = 2.0 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +3 / -1 Query: 123 KWTNARPCNERALVLY 170 +W+N PC +R L ++ Sbjct: 408 RWSNNIPCIDRTLYIF 361
>LOC_Os10g38740:12010.t03114:unspliced-genomic glutathione S-transferase GSTU6, putative, expressed| Length = 1643 Score = 27.6 bits (54), Expect(2) = 2.3 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 / +3 Query: 13 STTGPPTSATRCTPPSSTPS 72 +++ PPT TR +P STP+ Sbjct: 789 TSSSPPTRCTRASPSCSTPA 848 Score = 22.6 bits (43), Expect(2) = 2.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 / +1 Query: 291 CIHLYIKKKK 320 CIHLY+ KK Sbjct: 1579 CIHLYLHNKK 1608
>LOC_Os08g17080:12008.t01579:unspliced-genomic conserved hypothetical protein| Length = 2340 Score = 26.3 bits (51), Expect(2) = 2.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 / +1 Query: 144 CNERALVLYDE*WMRGYRKDPLL 212 C +RAL YDE G+ DP L Sbjct: 2155 CMQRALEYYDEMKENGFASDPKL 2223 Score = 24.4 bits (47), Expect(2) = 2.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 / +3 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAP 78 A R PP TR PP S P P Sbjct: 9 AAARRRRPPPPRPTRPPPPISAPLPP 86
>LOC_Os11g23210:12011.t01990:unspliced-genomic hypothetical protein| Length = 2361 Score = 31.3 bits (62), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 / -3 Query: 4 RVRSTTGPPTSATRCTPPSSTP 69 RV TTGPP S R PP TP Sbjct: 508 RVTPTTGPPLSGHRLMPPR*TP 443
>LOC_Os11g14870:12011.t01318:unspliced-genomic hypothetical protein| Length = 666 Score = 31.3 bits (62), Expect = 2.5 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAPLKWSVVEQFLSAQLQNGRTRVRVT 150 S++ PPT A P +S P++ WS+ + + + G TR R T Sbjct: 236 SSSTPPTPAPPPPPAASEPTSGSAWSICSRACLRRTR*GATRRRST 373
>LOC_Os11g04267:12011.t00319:unspliced-genomic hypothetical protein| Length = 1854 Score = 31.3 bits (62), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 / -2 Query: 7 VRSTTGPPTSATRCTPPSSTPSA 75 VR T+ PP S +R PPS +P A Sbjct: 254 VRPTSPPPRSTSRAAPPSLSPPA 186
>LOC_Os11g04260:12011.t00318:unspliced-genomic hypothetical protein| Length = 1854 Score = 31.3 bits (62), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 / -2 Query: 7 VRSTTGPPTSATRCTPPSSTPSA 75 VR T+ PP S +R PPS +P A Sbjct: 254 VRPTSPPPRSTSRAAPPSLSPPA 186
>LOC_Os10g39660:12010.t03207:unspliced-genomic expressed protein| Length = 1310 Score = 31.3 bits (62), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R S T PP T PPS TPS P Sbjct: 512 RATSPTVPPRETTPTRPPSPTPSRP 586
>LOC_Os09g09220:12009.t00716:unspliced-genomic protein kinase domain containing protein, expressed| Length = 8694 Score = 31.3 bits (62), Expect = 2.5 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPS 72 R ++T PP+ TR TPPS TP+ Sbjct: 131 RPATSTTPPSCPTRRTPPSPTPA 199
>LOC_Os08g14330:12008.t01308:unspliced-genomic apospory-associated protein C, putative, expressed| Length = 5440 Score = 31.3 bits (62), Expect = 2.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 / +3 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 RVR ++ PP+ PP S+PS P Sbjct: 111 RVRVSSSPPSRGAMAAPPPSSPSPP 185
>LOC_Os08g05910:12008.t00483:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 8130 Score = 31.3 bits (62), Expect = 2.5 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAPLKWSVVEQFLSAQLQNGRTR 138 +T G PT++TR + SST S+P S + S+ TR Sbjct: 7493 ATPGSPTTSTRASSTSSTGSSPASASPTSSYTSSPPGGTSTR 7618
>LOC_Os06g43130:12006.t04003:unspliced-genomic ABC-type sugar transport system, permease component, putative,| expressed Length = 2614 Score = 31.3 bits (62), Expect = 2.5 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 / +2 Query: 70 KVSKMVVCSGSLRWVAQLL 14 K+SKMV+CS L WV Q L Sbjct: 1859 KISKMVLCSMFLEWVLQFL 1915
>LOC_Os06g09310:12006.t00810:unspliced-genomic znf, putative, expressed| Length = 1495 Score = 31.3 bits (62), Expect = 2.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 / -3 Query: 13 STTGPPTSATRCTPPSSTPSA 75 +T PT AT C PPS +P+A Sbjct: 905 ATAAAPTPATSCRPPSCSPAA 843
>LOC_Os05g48330:12005.t04267:unspliced-genomic pepsin A, putative, expressed| Length = 3576 Score = 31.3 bits (62), Expect = 2.5 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 / +3 Query: 13 STTGPPTSATRCTPPSSTPSAPLK 84 S T T++ R TPP+++PSAP + Sbjct: 2721 SPTASSTTSPRATPPATSPSAPAR 2792
>LOC_Os05g47930:12005.t04228:unspliced-genomic OsQSOXL1 - Oryza sativa quiescin-sulfhydryl oxidase-like, expressed| Length = 5020 Score = 31.3 bits (62), Expect = 2.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 / +2 Query: 28 PTSATRCTPPSSTPSAPLKWS 90 PT + TPP+STPS+ +WS Sbjct: 224 PTPPSTSTPPTSTPSSRPRWS 286
>LOC_Os05g32370:12005.t02833:unspliced-genomic pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16, putative,| expressed Length = 3583 Score = 31.3 bits (62), Expect = 2.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 / -1 Query: 19 TGPPTSATRCTPPSSTP 69 + PP +A CTPPSS+P Sbjct: 1639 SSPPRAAAACTPPSSSP 1589
>LOC_Os05g03030:12005.t00200:unspliced-genomic structural constituent of ribosome, putative, expressed| Length = 912 Score = 31.3 bits (62), Expect = 2.5 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 / -1 Query: 25 PPTSATRCTPPSSTPSAP 78 P T TRC PP+ TP AP Sbjct: 198 P*TRGTRCPPPAGTPPAP 145
>LOC_Os04g28860:12004.t02581:unspliced-genomic conserved hypothetical protein| Length = 5860 Score = 31.3 bits (62), Expect = 2.5 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +1 / -1 Query: 1 ARVRSTTGPPTSATRCTPPSS 63 AR R TT PP + RCT PSS Sbjct: 763 ARRRRTTLPPAAPARCTRPSS 701
>LOC_Os03g58750:12003.t05128:unspliced-genomic receptor protein kinase CRINKLY4 precursor, putative, expressed| Length = 1470 Score = 31.3 bits (62), Expect = 2.5 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAPLKW 87 R RS P +AT C+PP S+P W Sbjct: 95 RSRSIRTRPAAATACSPPRSSPPRCCSW 178
>LOC_Os03g18120:12003.t01586:unspliced-genomic expressed protein| Length = 4706 Score = 31.3 bits (62), Expect = 2.5 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +1 / +3 Query: 34 SATRCTPPSSTPSAPLKWSVVEQFLSAQLQNGRTRVRVT 150 S+ TPPS TP AP WS S + TR+ T Sbjct: 2919 SSASSTPPSRTPRAPSPWSAAAPSPSTPSKYVPTRLTTT 3035
>LOC_Os02g47920:12002.t04376:unspliced-genomic RNA exonuclease 4, putative| Length = 2042 Score = 31.3 bits (62), Expect = 2.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S+T PP S T PP+S+P+ P Sbjct: 752 SSTAPPPSDTTAPPPASSPAPP 817
>LOC_Os04g02780:12004.t00172:unspliced-genomic ATAMI1, putative, expressed| Length = 3055 Score = 26.3 bits (51), Expect(2) = 3.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 / +2 Query: 25 PPTSATRCTPPSSTPSAPLKWS 90 PP S++ +PP+ SAP W+ Sbjct: 329 PPPSSSPRSPPAPPASAPPSWT 394 Score = 24.4 bits (47), Expect(2) = 3.1 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 / +3 Query: 94 VEQFLSAQLQNGRTRVRVTNVLWFC 168 V Q SAQLQ+G + + ++ ++C Sbjct: 1335 VGQITSAQLQSGENKDLLISINYYC 1409
>LOC_Os09g18080:12009.t01593:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 7244 Score = 24.4 bits (47), Expect(2) = 3.1 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +1 / +3 Query: 64 TPSAPLKWSVVEQFLSAQLQNGRTRVRVTNVLWF 165 T S P +WS V + R VT V WF Sbjct: 684 TMSLPCRWSPVHDVTVRKAT*ERRTKLVTRVAWF 785 Score = 23.5 bits (45), Expect(2) = 3.1 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 / +1 Query: 46 CTPPSSTPSAPLK 84 CTPP S S+PL+ Sbjct: 637 CTPPPSLGSSPLE 675
>LOC_Os09g39970:12009.t03461:unspliced-genomic conserved hypothetical protein| Length = 8389 Score = 25.8 bits (50), Expect(3) = 3.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 / +2 Query: 180 WMRGYRKDPLLIIMLVRSHRR 242 WMR Y++ L +L+ SH+R Sbjct: 6440 WMRFYKEQDFLPCLLLVSHKR 6502 Score = 22.6 bits (43), Expect(3) = 3.3 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 / +3 Query: 46 CTPPSSTPSAPLKWSVVEQFLS 111 C P SS+P +++V+ FLS Sbjct: 2724 CVPSSSSPLHNYYFNLVQLFLS 2789 Score = 21.7 bits (41), Expect(3) = 3.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPS 72 S+ PP A PP S PS Sbjct: 62 SSPTPPRRAPSLPPPPSPPS 121
>LOC_Os02g52650:12002.t04845:unspliced-genomic chlorophyll a-b binding protein 4, chloroplast precursor, putative,| expressed Length = 2201 Score = 30.9 bits (61), Expect = 3.3 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 / +1 Query: 6 GPLNNWATHLSDPLHTTIFDT 68 GP++N THLSDP + I T Sbjct: 1909 GPIDNLLTHLSDPFNKNIIHT 1971
>LOC_Os12g06220:12012.t00508:unspliced-genomic YLS9, putative, expressed| Length = 901 Score = 30.9 bits (61), Expect = 3.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 / +3 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S+TGP +S T PPS P++P Sbjct: 189 SSTGPSSSPTTSAPPSPPPTSP 254
>LOC_Os11g39670:12011.t03509:unspliced-genomic seryl-tRNA synthetase, putative, expressed| Length = 4405 Score = 30.9 bits (61), Expect = 3.4 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 / +2 Query: 16 TTGPPTSATRCTPPSSTPSA 75 T PPTSAT PP+ST S+ Sbjct: 434 TPSPPTSATATPPPTSTSSS 493
>LOC_Os10g36960:12010.t02969:unspliced-genomic transposon protein, putative, unclassified| Length = 1602 Score = 30.9 bits (61), Expect = 3.4 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 / +2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPS 72 A RS T P TS TRC+ + TPS Sbjct: 305 AAPRSPTAPRTSRTRCSARAGTPS 376
>LOC_Os09g23350:12009.t02019:unspliced-genomic ATTPS6, putative, expressed| Length = 4466 Score = 30.9 bits (61), Expect = 3.4 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 / +1 Query: 4 RVRSTTGPPTSATRCTPPSSTPSA 75 R R TT PPT R + PSS+P++ Sbjct: 919 RRRPTTPPPTPTRRASAPSSSPTS 990
>LOC_Os08g31890:12008.t02934:unspliced-genomic conserved hypothetical protein| Length = 1248 Score = 30.9 bits (61), Expect = 3.4 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 / +2 Query: 28 PTSATRCTPPSSTPSAP 78 P+SA+RC P ++TPS P Sbjct: 275 PSSASRCRPAATTPSGP 325
>LOC_Os06g40550:12006.t03751:unspliced-genomic ABC transporter-like protein, putative, expressed| Length = 6219 Score = 30.9 bits (61), Expect = 3.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPSSTPS 72 RS + PPT++TRC PS + S Sbjct: 3962 RSGSAPPTTSTRCASPSPSAS 4024
>LOC_Os06g34650:12006.t03162:unspliced-genomic RING-H2 finger protein ATL2L, putative, expressed| Length = 874 Score = 30.9 bits (61), Expect = 3.4 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S++ PP A+RC P +S+ SAP Sbjct: 197 SSSSPPPCASRCHPTTSSSSAP 262
>LOC_Os05g29760:12005.t02576:unspliced-genomic ferrochelatase-2, chloroplast precursor, putative, expressed| Length = 7197 Score = 30.9 bits (61), Expect = 3.4 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 / -1 Query: 25 PPTSATRCTPPSSTPSAPLKWSVVEQFLSAQL 120 PP S C+P S+T S+PL +V + +SA + Sbjct: 468 PPQSRPSCSPGSTTTSSPLPATVKKTNISATI 373
>LOC_Os04g57690:12004.t05235:unspliced-genomic expressed protein| Length = 3117 Score = 30.9 bits (61), Expect = 3.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 / -3 Query: 34 SATRCTPPSSTPSAPLKWSVV 96 +A R + P S P+ PLKWS V Sbjct: 2101 AAARASHPPSLPAGPLKWSTV 2039
>LOC_Os04g08640:12004.t00732:unspliced-genomic cadmium tolerance factor, putative, expressed| Length = 1457 Score = 30.9 bits (61), Expect = 3.4 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +1 / +1 Query: 28 PTSATRCTPPSSTPSAPLKWS 90 P +++ C+PP+ST + P+ WS Sbjct: 988 PCASSSCSPPTST*AIPVSWS 1050
>LOC_Os03g61780:12003.t05408:unspliced-genomic expressed protein| Length = 2853 Score = 30.9 bits (61), Expect = 3.4 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 / +3 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAP 78 AR S GP T+ T C P TPS P Sbjct: 1515 ARRSSPWGPATTQTPCRPTPPTPSTP 1592
>LOC_Os03g60720:12003.t05310:unspliced-genomic alpha-expansin 6 precursor, putative, expressed| Length = 3016 Score = 30.9 bits (61), Expect = 3.4 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 / -2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAPLKW 87 R RS T P + PP +TP+AP W Sbjct: 342 RARSATPRPRTPPGSAPPPATPAAPPLW 259
>LOC_Os03g51210:12003.t04451:unspliced-genomic expressed protein| Length = 1536 Score = 30.9 bits (61), Expect = 3.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 / +1 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R R PP+S + C+PP +P+AP Sbjct: 571 RCRPRPRPPSSTSPCSPPLWSPTAP 645
>LOC_Os03g44800:12003.t03864:unspliced-genomic expressed protein| Length = 3659 Score = 30.9 bits (61), Expect = 3.4 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAPLKWSVVEQFLSAQLQNGRTRVRVT 150 S+ PT R TPP ST SAP + + ++ ++G T R + Sbjct: 368 SSAASPTRRWRSTPPRSTTSAPPSPAAPATWRASAPRSGSTATRAS 505
>LOC_Os03g22010:12003.t01953:unspliced-genomic peroxidase 2 precursor, putative, expressed| Length = 5355 Score = 30.9 bits (61), Expect = 3.4 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +1 / +1 Query: 25 PPTSATRCTPPSSTPSAPLKW 87 P +++T TPP+STP++P W Sbjct: 4978 PSSASTPPTPPASTPTSPPPW 5040
>LOC_Os02g40590:12002.t03695:unspliced-genomic hypothetical protein| Length = 639 Score = 30.9 bits (61), Expect = 3.4 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +1 / +2 Query: 31 TSATRCTPPSSTPS 72 T+ TRCTPP STPS Sbjct: 110 TTMTRCTPPLSTPS 151
>LOC_Os02g35450:12002.t03183:unspliced-genomic DNA-repair protein XRCC3, putative| Length = 873 Score = 30.9 bits (61), Expect = 3.4 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLKWS 90 R + G PT+ RC+ P P P WS Sbjct: 691 RGSPGAPTTTPRCSRPPPPPRPPPGWS 611
>LOC_Os02g31910:12002.t02834:unspliced-genomic potassium transporter 1, putative, expressed| Length = 6584 Score = 30.9 bits (61), Expect = 3.4 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 / +3 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAPLKWS 90 AR R+ + T+++ +P SSTPS+ WS Sbjct: 3471 ARFRTASSTRTTSSASSPSSSTPSSSSPWS 3560
>LOC_Os02g06560:12002.t00554:unspliced-genomic wound induced protein, putative, expressed| Length = 267 Score = 30.9 bits (61), Expect = 3.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 ST+ PP C PPS TP P Sbjct: 122 STSAPPPPRPGCVPPSPTPPPP 187
>LOC_Os01g61510:12001.t05530:unspliced-genomic ammonium transporter 2, putative, expressed| Length = 2513 Score = 30.9 bits (61), Expect = 3.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 / -2 Query: 19 TGPPTSATRCTPPSSTPSAPL 81 T PP +ATRC S+TP+ P+ Sbjct: 103 TSPPRAATRCPRCSATPAPPV 41
>LOC_Os01g51690:12001.t04600:unspliced-genomic OsWRKY26 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 2143 Score = 30.9 bits (61), Expect = 3.4 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +1 / -1 Query: 28 PTSATRCTPPSSTPSA 75 P S++RCTPPSST S+ Sbjct: 1573 PPSSSRCTPPSSTGSS 1526
>LOC_Os01g11970:12001.t01066:unspliced-genomic conserved hypothetical protein| Length = 744 Score = 30.9 bits (61), Expect = 3.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = +1 / +2 Query: 43 RCTPPSSTPSAP 78 RCTPPSS+PS+P Sbjct: 203 RCTPPSSSPSSP 238
>LOC_Os01g03670:12001.t00258:unspliced-genomic dihydroflavonol-4-reductase, putative, expressed| Length = 1332 Score = 30.9 bits (61), Expect = 3.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 / +2 Query: 31 TSATRCTPPSSTPSAPLKWSVVEQFLSAQLQNGRTR 138 TS+ RC+PP++ + P + V A N RTR Sbjct: 92 TSSARCSPPATPSAPPSETQVTRTHTCAVEANDRTR 199
>LOC_Os07g48350:12007.t04584:unspliced-genomic expressed protein| Length = 7866 Score = 29.0 bits (57), Expect(2) = 3.7 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 / +3 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAPLKW 87 AR + PTSA+R TPP S+ W Sbjct: 255 ARTSPGSSSPTSASRTTPPRCGSSSATPW 341 Score = 22.6 bits (43), Expect(2) = 3.7 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = +3 / +3 Query: 279 MVTQCIHLYI 308 M+T C+HLY+ Sbjct: 5226 MLTPCLHLYV 5255
>LOC_Os03g11670:12003.t00968:unspliced-genomic salt-inducible protein, putative, expressed| Length = 2276 Score = 26.3 bits (51), Expect(2) = 4.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 / +3 Query: 10 RSTTGPPTSATRCTPPSSTP 69 R GPP S +RC S TP Sbjct: 399 RPPPGPPPSCSRCGGSSGTP 458 Score = 23.5 bits (45), Expect(2) = 4.1 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 / +2 Query: 150 ERALVLYDE*WMRGYRKDPLLIIMLVRSH 236 E AL LYD ++ DP++ ++R H Sbjct: 734 ETALRLYDRARAEKWQLDPVICATVIRVH 820
>LOC_Os12g44010:12012.t04067:unspliced-genomic purple acid phosphatase precursor, putative, expressed| Length = 2433 Score = 30.4 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 / +3 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S+T PP+ A+ P ++TPSAP Sbjct: 378 SSTTPPSPASTTAPSTTTPSAP 443
>LOC_Os12g43970:12012.t04063:unspliced-genomic epoxide hydrolase 2, putative, expressed| Length = 2478 Score = 30.4 bits (60), Expect = 4.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 / +3 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S PPTSA TPPS T P Sbjct: 189 SAPSPPTSAATATPPSPTTPPP 254
>LOC_Os12g39210:12012.t03601:unspliced-genomic cyclin-A2, putative, expressed| Length = 2254 Score = 30.4 bits (60), Expect = 4.7 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 / +1 Query: 4 RVRSTTGPPTSATRCTPPSSTPSA 75 R R PP TR TPP+STP++ Sbjct: 385 RRRRRRRPPPVGTRSTPPTSTPTS 456
>LOC_Os11g30450:12011.t02649:unspliced-genomic hypothetical protein| Length = 261 Score = 30.4 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 / -2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 ++T PP S+ PP STPS+P Sbjct: 239 ASTSPPPSSPPPNPPPSTPSSP 174
>LOC_Os11g04010:12011.t00291:unspliced-genomic caspase, putative, expressed| Length = 1653 Score = 30.4 bits (60), Expect = 4.7 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSA 75 R S P T+A RC+PP+ T SA Sbjct: 236 RPTSPCSPTTAARRCSPPAPTSSA 307
>LOC_Os10g40430:12010.t03283:unspliced-genomic cortical cell-delineating protein precursor, putative, expressed| Length = 797 Score = 30.4 bits (60), Expect = 4.7 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 / +2 Query: 28 PTSATRCTPPSSTPSAP 78 PT+A RC+P S TP+ P Sbjct: 350 PTTAARCSPASPTPTPP 400
>LOC_Os10g24094:12010.t003579:unspliced-genomic expressed protein| Length = 5428 Score = 30.4 bits (60), Expect = 4.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 / -2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R R+ P +A CTPPS+TP P Sbjct: 2838 RRRARLALPPTAHPCTPPSTTPPPP 2764
>LOC_Os10g24090:12010.t01835:unspliced-genomic expressed protein| Length = 2762 Score = 30.4 bits (60), Expect = 4.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R R+ P +A CTPPS+TP P Sbjct: 2591 RRRARLALPPTAHPCTPPSTTPPPP 2665
>LOC_Os09g39430:12009.t03408:unspliced-genomic carboxylic ester hydrolase/ hydrolase, acting on ester bonds,| putative, expressed Length = 4018 Score = 30.4 bits (60), Expect = 4.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 / +1 Query: 25 PPTSATRCTPPSSTPSAP 78 PP+S++ TPPSST S P Sbjct: 3406 PPSSSSTSTPPSSTSSPP 3459
>LOC_Os08g45030:12008.t04224:unspliced-genomic multidrug resistance protein 1, putative, expressed| Length = 5864 Score = 30.4 bits (60), Expect = 4.7 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 / +1 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 ST P S++ +P SSTPSAP Sbjct: 607 STAAPSRSSSASSPTSSTPSAP 672
>LOC_Os08g16130:12008.t01487:unspliced-genomic fiber protein Fb34, putative, expressed| Length = 3066 Score = 30.4 bits (60), Expect = 4.7 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 STT PT++T TPP ST S P Sbjct: 326 STTCGPTASTTPTPPPSTASRP 391
>LOC_Os08g06570:12008.t00547:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6141 Score = 30.4 bits (60), Expect = 4.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 / +2 Query: 16 TTGPPTSATRCTPPSSTPSAPLKWSVVEQ 102 TT +++ +PP TP A KWSV Q Sbjct: 5519 TTAKTWASSSASPPPPTPEAMAKWSVPTQ 5605
>LOC_Os07g47194:12007.t04355:unspliced-genomic GEX1, putative, expressed| Length = 3906 Score = 30.4 bits (60), Expect = 4.7 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 / -2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R TT PP + R PPSS P+ P Sbjct: 914 RCSCTTPPPAPSRRRAPPSSPPALP 840
>LOC_Os07g44900:12007.t04130:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1041 Score = 30.4 bits (60), Expect = 4.7 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPSSTPSA 75 R+TTG P+SAT P S T SA Sbjct: 404 RTTTGRPSSATSAPPASPTTSA 469
>LOC_Os07g40740:12007.t03733:unspliced-genomic heparanase-like protein 3 precursor, putative, expressed| Length = 2059 Score = 30.4 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 / +1 Query: 4 RVRSTTGPPTSATRCTPPSSTP 69 R R+ PP + TRCTP + TP Sbjct: 802 RSRAGGRPPAARTRCTPATGTP 867 Score = 29.5 bits (58), Expect = 8.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 / +3 Query: 10 RSTTGPPTSATRCTPPSSTP 69 RST GP TSAT P +TP Sbjct: 204 RSTGGPGTSATTACAPGTTP 263
>LOC_Os07g12880:12007.t01159:unspliced-genomic transposon protein, putative, Pong sub-class| Length = 1311 Score = 30.4 bits (60), Expect = 4.7 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 / -2 Query: 282 PLVHILQITKSQQLSYVIGPAL*STKDLCDTLSSITRHTKPK 157 P+V+ T + V+ +L* + DLC TL S+ PK Sbjct: 863 PIVYFFPFTINSSSGAVLDVSL*KSGDLCSTLISLREPGSPK 738
>LOC_Os07g06080:12007.t00490:unspliced-genomic D-amino acid oxidase, putative, expressed| Length = 2069 Score = 30.4 bits (60), Expect = 4.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 / +2 Query: 25 PPTSATRCTPPSSTPSAP 78 PP RC+PP STP P Sbjct: 371 PPPRRPRCSPPGSTPPRP 424
>LOC_Os05g47510:12005.t04187:unspliced-genomic conserved hypothetical protein| Length = 1323 Score = 30.4 bits (60), Expect = 4.7 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPSSTPSAPL 81 R T S C+PPSST SAPL Sbjct: 254 RCTPAARRSVPPCSPPSSTTSAPL 325
>LOC_Os05g04440:12005.t00340:unspliced-genomic peroxidase 24 precursor, putative, expressed| Length = 1458 Score = 30.4 bits (60), Expect = 4.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 / +2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAPLKWS 90 +R R T P TSAT + S P+A WS Sbjct: 581 SRTRRATRPGTSATAASTSPSLPAASTAWS 670
>LOC_Os03g19630:12003.t01728:unspliced-genomic tuber-specific and sucrose-responsive element binding factor,| putative Length = 570 Score = 30.4 bits (60), Expect = 4.7 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 / +2 Query: 16 TTGPPTSATRCTPPSSTPSA 75 TT P TS+T +PP +TPS+ Sbjct: 227 TTSPVTSSTAISPPPTTPSS 286
>LOC_Os03g07310:12003.t00594:unspliced-genomic axi 1 protein, putative, expressed| Length = 3722 Score = 30.4 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 / -3 Query: 4 RVRSTTGPPTSATRCTPPSSTP 69 R R+ PT+A RCTPP + P Sbjct: 255 RPRAARRRPTAARRCTPPGAKP 190
>LOC_Os03g06350:12003.t00504:unspliced-genomic plant-specific domain TIGR01568 family protein, expressed| Length = 1487 Score = 30.4 bits (60), Expect = 4.7 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 / +2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAP 78 A RSTTG PTS + P+S+ ++P Sbjct: 614 ATSRSTTGAPTSTSSAPSPTSSSASP 691
>LOC_Os03g05510:12003.t00423:unspliced-genomic ramosa 2, putative, expressed| Length = 864 Score = 30.4 bits (60), Expect = 4.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 / +2 Query: 22 GPPTSATRCTPPSSTPSAPLKWS 90 G T +TRCT SST AP W+ Sbjct: 629 GRTTCSTRCTTRSSTRRAPAPWT 697
>LOC_Os02g58230:12002.t05394:unspliced-genomic C2 domain containing protein, expressed| Length = 5162 Score = 30.4 bits (60), Expect = 4.7 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 / +1 Query: 25 PPTSATRCTPPSSTPSAPLKWSVVEQFLSA 114 PP A RC P S P APL S LSA Sbjct: 265 PPPPALRCRRPPSPPLAPLPASSPPSSLSA 354
>LOC_Os02g58170:12002.t05388:unspliced-genomic transposon protein, putative, Ac/Ds sub-class| Length = 7998 Score = 30.4 bits (60), Expect = 4.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R ++T PPT T PSS+P++P Sbjct: 212 RAAASTTPPTPTPTSTSPSSSPTSP 286
>LOC_Os02g35300:12002.t03168:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 3688 Score = 30.4 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S+ PP R +PPS TPS+P Sbjct: 434 SSRSPPRRTPRWSPPSCTPSSP 499
>LOC_Os02g12690:12002.t01066:unspliced-genomic cytochrome P450 74A4, putative, expressed| Length = 1908 Score = 30.4 bits (60), Expect = 4.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 +T PP SA+ C P S+P+ P Sbjct: 269 ATAAPPCSASTCRPAPSSPATP 334
>LOC_Os02g12680:12002.t01065:unspliced-genomic cytochrome P450 74A3, putative, expressed| Length = 1721 Score = 30.4 bits (60), Expect = 4.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 +T PP SA+ C P S+P+ P Sbjct: 269 ATAAPPCSASTCRPAPSSPATP 334
>LOC_Os02g09450:12002.t00792:unspliced-genomic glycerophosphodiester phosphodiesterase/ kinase, putative, expressed| Length = 4804 Score = 30.4 bits (60), Expect = 4.7 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSS 63 S+ G PTS T CTPP+S Sbjct: 3095 SSRGSPTSPTGCTPPTS 3145
>LOC_Os01g71070:12001.t06404:unspliced-genomic xylanase inhibitor TAXI-IV, putative, expressed| Length = 1484 Score = 30.4 bits (60), Expect = 4.7 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLK 84 RS PPT+ATR T S PS P + Sbjct: 410 RSPRTPPTAATRSTRSPSRPSPPAR 484
>LOC_Os01g65150:12001.t05881:unspliced-genomic expressed protein| Length = 2103 Score = 30.4 bits (60), Expect = 4.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAPLKWSV 93 S PPT A+ T PS P+ + WSV Sbjct: 374 SARSPPTRASGGTAPSWPPACSISWSV 454
>LOC_Os01g65000:12001.t05867:unspliced-genomic ammonium transporter 2, putative, expressed| Length = 2362 Score = 30.4 bits (60), Expect = 4.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 / -1 Query: 25 PPTSATRCTPPSSTPSAP 78 P +SATRC P S+TP+ P Sbjct: 103 PRSSATRCRPCSATPAPP 50
>LOC_Os01g36950:12001.t03244:unspliced-genomic N-rich protein, putative, expressed| Length = 2948 Score = 30.4 bits (60), Expect = 4.7 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +1 / +3 Query: 13 STTGPPTSATRCTPPSSTPSAPLKWSVVEQFLSAQLQNGRT 135 +TT P + R T +STPS +W V +A T Sbjct: 378 TTTSPTAAPPRSTTTTSTPSGSTRWGVTTTAATAAATTAAT 500
>LOC_Os01g14720:12001.t01328:unspliced-genomic transcription regulator, putative, expressed| Length = 1209 Score = 30.4 bits (60), Expect = 4.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 +T+GPP S+ PP++T S P Sbjct: 281 ATSGPPPSSATAPPPTTTTSTP 346
>LOC_Os01g04770:12001.t00365:unspliced-genomic hypothetical protein| Length = 909 Score = 30.4 bits (60), Expect = 4.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 / +1 Query: 49 TPPSSTPSAPLKWSVVEQFLSAQLQNGRTRV 141 +PPSS+P A W +E+F + R RV Sbjct: 673 SPPSSSPLASPSWMALEEFPPGTEDDARARV 765
>LOC_Os09g27830:12009.t02461:unspliced-genomic OsPDIL2-3 - Oryza sativa protein disulfide isomerase, expressed| Length = 4984 Score = 27.2 bits (53), Expect(2) = 4.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S++ PP S R PPS+ P+ P Sbjct: 179 SSSSPPPSRPRRFPPSTPPALP 244 Score = 23.5 bits (45), Expect(2) = 4.7 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 / +3 Query: 218 NAGPIT*ESCWDLVIC 265 N ++* CWDL++C Sbjct: 3144 NGLTLS*GICWDLILC 3191
>LOC_Os01g42410:12001.t03759:unspliced-genomic PDR5-like ABC transporter, putative, expressed| Length = 8064 Score = 28.6 bits (56), Expect(2) = 5.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +1 / +2 Query: 31 TSATRCTPPSSTPS 72 TSAT +PPSSTPS Sbjct: 389 TSATAASPPSSTPS 430 Score = 22.6 bits (43), Expect(2) = 5.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 / +3 Query: 157 LWFCMTSDG 183 LWFC TS G Sbjct: 6876 LWFCSTSGG 6902
>LOC_Os12g30940:12012.t02800:unspliced-genomic F-box domain containing protein| Length = 2388 Score = 27.2 bits (53), Expect(2) = 6.0 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSA 75 +T GP TSATR + P++ S+ Sbjct: 332 TTAGPTTSATRSSAPATASSS 394 Score = 22.1 bits (42), Expect(2) = 6.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 / +2 Query: 95 SSSFCQLSCKMDERAS 142 S S C+ C MDE S Sbjct: 2036 SLSLCRCGCYMDEETS 2083
>LOC_Os12g26540:12012.t02367:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 2498 Score = 29.9 bits (59), Expect = 6.4 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 / +3 Query: 4 RVRSTTGPPTSATRCTPPSSTPSA 75 R RSTTG TSA +PP P+A Sbjct: 117 RRRSTTGLATSAASASPPRRRPTA 188
>LOC_Os12g06060:12012.t00492:unspliced-genomic high-affinity cationic amino acid transporter 1, putative,| expressed Length = 6504 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 / +2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAP 78 AR S P ++ R +PPS+TPS+P Sbjct: 107 ARPSSCRTPLPASARSSPPSATPSSP 184
>LOC_Os12g05450:12012.t00433:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6393 Score = 29.9 bits (59), Expect = 6.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 / -2 Query: 25 PPTSATRCTPPSSTPSAPL 81 PP + R PP+STP +PL Sbjct: 5003 PPCATARWAPPASTPPSPL 4947 Score = 29.9 bits (59), Expect = 6.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 / -3 Query: 25 PPTSATRCTPPSSTPSAPL 81 PP + R PP+STP +PL Sbjct: 121 PPCATARWAPPASTPPSPL 65
>LOC_Os12g03816:12012.t00273:unspliced-genomic calmodulin-related protein, putative, expressed| Length = 1710 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPS 72 R R+ + PPTS+ P S+TPS Sbjct: 614 RTRTASSPPTSSATSWPTSATPS 682
>LOC_Os11g28610:12011.t02473:unspliced-genomic hexose transporter, putative, expressed| Length = 2599 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 / +1 Query: 13 STTGPPTSATRCTPPSSTPSA 75 S +GPPTS + +P SST SA Sbjct: 316 SCSGPPTSTSSSSPASSTASA 378
>LOC_Os11g03980:12011.t00288:unspliced-genomic calmodulin-6, putative| Length = 733 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPS 72 R R+ + PPTS+ P S+TPS Sbjct: 299 RTRTASSPPTSSATSWPTSATPS 367
>LOC_Os10g41534:12010.t03389:unspliced-genomic ICE-like protease p20 domain containing protein, expressed| Length = 7819 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 / +3 Query: 25 PPTSATRCTPPSSTPSAP 78 P SA R PPSS PSAP Sbjct: 615 PSRSAARADPPSSGPSAP 668
>LOC_Os10g37660:12010.t03026:unspliced-genomic trehalase precursor, putative, expressed| Length = 4636 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 / -2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R R T P S +RC PPS +AP Sbjct: 288 RRRGRTRPARSTSRCRPPSRPSTAP 214
>LOC_Os10g37190:12010.t02988:unspliced-genomic protein kinase domain containing protein, expressed| Length = 1845 Score = 29.9 bits (59), Expect = 6.4 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLKWS 90 R+ + PP+S PP + P+ P WS Sbjct: 1076 RAASSPPSSRRASGPPPAPPATPACWS 1156
>LOC_Os10g17780:12010.t01334:unspliced-genomic oxidoreductase, FAD-binding family protein| Length = 1368 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 / +2 Query: 31 TSATRCTPPSSTPSAPLKWS 90 TS++RCT +STPS+P+ S Sbjct: 503 TSSSRCTSRTSTPSSPMAGS 562
>LOC_Os10g03530:12010.t00242:unspliced-genomic CCR4-NOT transcription complex subunit 7, putative| Length = 783 Score = 29.9 bits (59), Expect = 6.4 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAPLK 84 R R + PTS TP SSTPS+ K Sbjct: 257 RSRGRSSSPTSTPAATPTSSTPSSSSK 337
>LOC_Os10g03360:12010.t00225:unspliced-genomic taxadien-5-alpha-ol-O-acetyltransferase, putative| Length = 1266 Score = 29.9 bits (59), Expect = 6.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 / -3 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAPLKWSVV 96 AR R+ P SA R PPSST W V Sbjct: 1045 ARSRTHPAAPCSARRSRPPSSTSPVSPPWRAV 950
>LOC_Os09g38860:12009.t03353:unspliced-genomic hypothetical protein| Length = 1621 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S+T PTS T PP TPS+P Sbjct: 242 SSTARPTSPTTPMPPPPTPSSP 307
>LOC_Os09g24340:12009.t02117:unspliced-genomic ATP binding protein, putative, expressed| Length = 1444 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 / -3 Query: 19 TGPPTSATRCTPPSSTPSAP 78 T PP A RC+ PS T S P Sbjct: 785 TSPPGRAARCSSPSCTASTP 726
>LOC_Os09g24320:12009.t02115:unspliced-genomic 2-oxo acid dehydrogenases acyltransferase family protein,| expressed Length = 2730 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 / +3 Query: 19 TGPPTSATRCTPPSSTPSAPLKWS 90 T P SA PP +T S+PL WS Sbjct: 21 TRSPDSAAAAAPPPATCSSPLWWS 92
>LOC_Os09g20810:12009.t01815:unspliced-genomic strictosidine synthase 3 precursor, putative| Length = 3227 Score = 29.9 bits (59), Expect = 6.4 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 / -2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAP 78 AR RS PP S++ TPP S S P Sbjct: 445 ARTRSPPPPPPSSSLRTPPPSCKSTP 368
>LOC_Os08g36500:12008.t03390:unspliced-genomic nitrate reductase 1, putative, expressed| Length = 4155 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 / +2 Query: 31 TSATRCTPPSSTPSAPLKWS 90 TS++RCT +STPS+P+ S Sbjct: 3044 TSSSRCTSRTSTPSSPMAGS 3103
>LOC_Os08g36480:12008.t03388:unspliced-genomic nitrate reductase 1, putative, expressed| Length = 5366 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 / +2 Query: 31 TSATRCTPPSSTPSAPLKWS 90 TS++RCT +STPS+P+ S Sbjct: 4418 TSSSRCTSRTSTPSSPMAGS 4477
>LOC_Os08g31870:12008.t02932:unspliced-genomic cell division cycle protein 48, putative, expressed| Length = 4002 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 / +3 Query: 4 RVRSTTGPPTSATRCTPPSSTPS 72 R S+TGPP A RC S PS Sbjct: 1929 RASSSTGPPAPARRCLRAPSPPS 1997
>LOC_Os08g21590:12008.t01952:unspliced-genomic phosphatidylinositol 3-kinase, root isoform, putative, expressed| Length = 20040 Score = 29.9 bits (59), Expect = 6.4 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 / +2 Query: 324 FFFFF*CTSGCI 289 FFFFF CT GCI Sbjct: 9461 FFFFFFCTQGCI 9496
>LOC_Os08g20570:12008.t01871:unspliced-genomic chloride channel-like protein CLC-g, putative, expressed| Length = 6286 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 / +1 Query: 13 STTGPPTSATRCTPPSSTPSAPLKWS 90 S TS +R +P SSTP P WS Sbjct: 826 SPASSSTSPSRMSPASSTPPCPPSWS 903
>LOC_Os08g01620:12008.t00061:unspliced-genomic shwachman-Bodian-Diamond syndrome protein, putative, expressed| Length = 3226 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 / +3 Query: 13 STTGPPTSATRCTPPSSTPSAPLKWS 90 S+ P SA +PPSST S P W+ Sbjct: 372 SSRSPARSARPSSPPSSTRSPPSSWT 449
>LOC_Os07g49260:12007.t04554:unspliced-genomic protein transporter, putative, expressed| Length = 8120 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 / +1 Query: 25 PPTSATRCTPPSSTPSAPLK 84 PP RCT SST SAP K Sbjct: 187 PPAMCRRCTQSSSTRSAPTK 246
>LOC_Os07g43010:12007.t03949:unspliced-genomic expressed protein| Length = 3854 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 / -1 Query: 10 RSTTGPPTSATRCTPPSSTPSAPL 81 R+ T PP SA +PP S P PL Sbjct: 365 RTRTSPPPSAPTPSPPPSPPPPPL 294
>LOC_Os07g39910:12007.t03652:unspliced-genomic pentatricopeptide repeat protein PPR1106-17, putative| Length = 2427 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 / +2 Query: 25 PPTSATRCTPPSSTPSAP 78 PP +A+ PPSSTPS P Sbjct: 314 PPPAASGTPPPSSTPSRP 367
>LOC_Os07g29310:12007.t02621:unspliced-genomic OsSAUR30 - Auxin-responsive SAUR gene family member, expressed| Length = 968 Score = 29.9 bits (59), Expect = 6.4 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 / +2 Query: 25 PPTSATRCTPPSSTPSA 75 PPT++TR +PPS+ P A Sbjct: 362 PPTASTRSSPPSAPPPA 412
>LOC_Os07g07320:12007.t00610:unspliced-genomic glutathione S-transferase GSTU6, putative, expressed| Length = 1035 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S++ PPT +TR +P SST + P Sbjct: 188 SSSSPPTPSTRRSPSSSTAATP 253
>LOC_Os06g23840:12006.t02196:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4852 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 / +3 Query: 16 TTGPPTSATRCTPPSSTPSAPLKWS 90 TT +++ +PPS TP A KWS Sbjct: 4230 TTAKTWASSSASPPSPTPEAMAKWS 4304
>LOC_Os06g22600:12006.t02074:unspliced-genomic ALMT1, putative, expressed| Length = 2260 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 / -2 Query: 13 STTGPPTSATRCTPPSSTPSA 75 S + P SAT+CTP +S P A Sbjct: 567 SASSPDLSATQCTPSASAPPA 505
>LOC_Os06g11860:12006.t01063:unspliced-genomic transcription factor DRE-binding factor 2, putative, expressed| Length = 2074 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 / +3 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 RS PTS R TPPS+ S P Sbjct: 1353 RSAAAAPTSPARSTPPSTPSSPP 1421
>LOC_Os06g11420:12006.t01019:unspliced-genomic SNW domain-containing protein 1, putative| Length = 1623 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 R T P S RCTPPS P P Sbjct: 878 R*ATPSPRSPRRCTPPSRRPGRP 946
>LOC_Os05g39240:12005.t03466:unspliced-genomic ammonium transporter 2, putative, expressed| Length = 4220 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 / -1 Query: 19 TGPPTSATRCTPPSSTPSA 75 T PP A+ +PP+STPSA Sbjct: 452 TAPPARASTGSPPASTPSA 396
>LOC_Os05g25800:12005.t02235:unspliced-genomic transposon protein, putative, unclassified| Length = 4536 Score = 29.9 bits (59), Expect = 6.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 / -2 Query: 268 FTNHQVPAALLCDRTSIIINKGSLRYPLIHHSSY 167 F+N +P A C R ++ GS R P HH S+ Sbjct: 3941 FSNMPIPLASPCIRRPLLQRVGSRRSPPRHHPSH 3840
>LOC_Os05g05920:12005.t00482:unspliced-genomic desiccation-related protein PCC13-62 precursor, putative, expressed| Length = 1097 Score = 29.9 bits (59), Expect = 6.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAPLKWS 90 +++ PPTS+ PP + SAP W+ Sbjct: 536 TSSSPPTSSPTSPPPPPSASAPPSWA 613
>LOC_Os04g55350:12004.t05008:unspliced-genomic PE-PGRS family protein, putative| Length = 2231 Score = 29.9 bits (59), Expect = 6.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 / -1 Query: 25 PPTSATRCTPPSSTPSAPL 81 PP + R PP+STP +PL Sbjct: 83 PPCATARWAPPASTPPSPL 27
>LOC_Os04g51890:12004.t04665:unspliced-genomic OsSAUR20 - Auxin-responsive SAUR gene family member, expressed| Length = 895 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 R+T P +A TPP+ +PSAP Sbjct: 539 RTTPPPSATAATSTPPTRSPSAP 607
>LOC_Os04g41970:12004.t03752:unspliced-genomic glycoside transferase, six-hairpin, subgroup, putative, expressed| Length = 3861 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 / +1 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 RV S + A+RC+ PS TPS+P Sbjct: 2878 RVGSRSSTTGRASRCSTPSPTPSSP 2952
>LOC_Os04g41680:12004.t03725:unspliced-genomic endochitinase A precursor, putative, expressed| Length = 1195 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 / -1 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAP 78 AR RST+ P +AT C S+P +P Sbjct: 688 ARARSTSSPAGTATACCSCRSSPCSP 611
>LOC_Os04g39420:12004.t03512:unspliced-genomic 6-phosphofructokinase 2, putative, expressed| Length = 2377 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 / +1 Query: 13 STTGPPTSATRCTPPSSTPSA 75 ST PP+++ R T PS+TPS+ Sbjct: 286 STRRPPSTSPRVTSPSATPSS 348
>LOC_Os04g35970:12004.t03267:unspliced-genomic F-box domain containing protein| Length = 3456 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 / +2 Query: 28 PTSATRCTPPSSTPSAP 78 PT RC PSSTPS+P Sbjct: 1670 PTG*ARCRTPSSTPSSP 1720
>LOC_Os03g53780:12003.t04696:unspliced-genomic ammonium transporter 2, putative| Length = 1495 Score = 29.9 bits (59), Expect = 6.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 / -1 Query: 25 PPTSATRCTPPSSTPSAP 78 PP +ATRC P TP+ P Sbjct: 64 PPLAATRCPPSPPTPAPP 11
>LOC_Os03g41470:12003.t03562:unspliced-genomic conserved hypothetical protein| Length = 2639 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 / +3 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 R + PP+SA TPP PS+P Sbjct: 1305 RPRSSPPSSAKPATPPRPPPSSP 1373
>LOC_Os03g26870:12003.t02368:unspliced-genomic GAMYB-binding protein, putative, expressed| Length = 5384 Score = 29.9 bits (59), Expect = 6.4 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 / +1 Query: 25 PPTSATRCTPPSSTPS 72 PPTS+T TPP +TP+ Sbjct: 4630 PPTSSTSTTPPRATPT 4677
>LOC_Os03g25920:12003.t02285:unspliced-genomic cationic amino acid transporter, putative| Length = 2790 Score = 29.9 bits (59), Expect = 6.4 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 +++ PP S + C P+STPS+P Sbjct: 2363 ASSPPPPSPSPCRSPASTPSSP 2428
>LOC_Os03g02190:12003.t00111:unspliced-genomic receptor protein kinase CRINKLY4 precursor, putative, expressed| Length = 1762 Score = 29.9 bits (59), Expect = 6.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 / -2 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLKWSVVEQFLSAQLQNGRTRVR 144 R +TG + RCTPP + P +P + S + + R R R Sbjct: 1188 RPSTGGGSGCRRCTPPPAPPRSPPRRRCTGTLASRRRASPRRRRR 1054
>LOC_Os02g58390:12002.t05410:unspliced-genomic receptor-kinase isolog, putative, expressed| Length = 5164 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 / +1 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R+ T PP + TRC+P S +AP Sbjct: 301 RLTLTLAPPPTRTRCSPSSPPSTAP 375
>LOC_Os02g53920:12002.t04971:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 557 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 / +2 Query: 1 ARVRSTTGPPTSATRCTPPSST 66 AR T PPTS T CTP T Sbjct: 65 ARSNQTKYPPTSCTSCTPMQQT 130
>LOC_Os02g47430:12002.t04327:unspliced-genomic expressed protein| Length = 853 Score = 29.9 bits (59), Expect = 6.4 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 / -3 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLKWS 90 R T PPTSA+RC + T S PL S Sbjct: 380 RPTQTPPTSASRCHRTARTAS*PLSAS 300
>LOC_Os02g41650:12002.t03751:unspliced-genomic phenylalanine ammonia-lyase, putative, expressed| Length = 4518 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 / +2 Query: 1 ARVRSTTGPPTSATRCTPPSSTPSAP 78 A R T P ++A C+P +TP+AP Sbjct: 3335 ASARRTCSPRSTARPCSPTPTTPAAP 3412
>LOC_Os02g17534:12002.t01546:unspliced-genomic fucosyltransferase 8, putative, expressed| Length = 6984 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 / +3 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 +T G T+++ +PPSSTPS+P Sbjct: 5541 TTAG*ATASSPSSPPSSTPSSP 5606
>LOC_Os02g07850:12002.t00681:unspliced-genomic conserved hypothetical protein| Length = 2909 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 / -2 Query: 7 VRSTTGPPTSATRCTPPSSTPSAPLK 84 VRS+ PP+S PPS+ P P K Sbjct: 772 VRSSRDPPSSLPPPPPPSAAPQPPAK 695
>LOC_Os02g01150:12002.t00015:unspliced-genomic hydroxypyruvate reductase, putative, expressed| Length = 4470 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 / +1 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLKWS 90 RS PP+SA+ C P S+ +A +W+ Sbjct: 3871 RSGCAPPSSASPCPPTWSSATARTRWA 3951
>LOC_Os02g01140:12002.t00014:unspliced-genomic anther-specific proline-rich protein APG precursor, putative,| expressed Length = 1410 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 / -3 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLKWS 90 RS PP+SA+ C P S+ +A +W+ Sbjct: 913 RSGCAPPSSASPCPPTWSSATARTRWA 833
>LOC_Os01g70330:12001.t06334:unspliced-genomic prefoldin subunit family protein, expressed| Length = 4684 Score = 29.9 bits (59), Expect = 6.4 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 / -3 Query: 322 FFFFLMYKWMH*VTIGS 272 FFFF + KW++*V +GS Sbjct: 1295 FFFFFLPKWLN*VALGS 1245
>LOC_Os01g69870:12001.t06290:unspliced-genomic expressed protein| Length = 1670 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 / +1 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 +T G S RC+PPSS P P Sbjct: 130 TTRGSSGSCARCSPPSSPPPPP 195
>LOC_Os01g18490:12001.t01642:unspliced-genomic hypothetical protein| Length = 665 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 / +1 Query: 7 VRSTTGPPTSATRCTPPSSTPSA 75 V ST GPP+S+TRC +P+A Sbjct: 583 VTSTGGPPSSSTRCIAGC*SPAA 651
>LOC_Os01g09700:12001.t00847:unspliced-genomic 1-aminocyclopropane-1-carboxylate synthase 7, putative, expressed| Length = 3610 Score = 29.9 bits (59), Expect = 6.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 / +1 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 R ST+ PTS T PP+ P+AP Sbjct: 1810 RSPSTSSRPTSVTTRRPPAGAPAAP 1884
>LOC_Os01g04409:12001.t00328:unspliced-genomic OsWAK1 - OsWAK receptor-like cytoplasmic kinase (OsWAK-RLCK),| expressed Length = 9675 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPSST 66 R T G PT+AT C P+ST Sbjct: 413 RHTKGSPTAATACAAPTST 469
>LOC_Os01g01180:12001.t00018:unspliced-genomic expressed protein| Length = 219 Score = 29.9 bits (59), Expect = 6.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 / +2 Query: 25 PPTSATRCTPPSSTPSAPLKWS 90 P + + TP SS+PSAP WS Sbjct: 125 PASPPSSSTPSSSSPSAPSSWS 190
>LOC_Os01g54220:12001.t04839:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 7553 Score = 28.1 bits (55), Expect(2) = 6.4 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 / -3 Query: 10 RSTTGPPTSATRCTPPSSTPSAPLKWSVV 96 + TT + RCT P+STP +P + +V+ Sbjct: 4200 KKTTDKLITQRRCTNPTSTPVSPHRGTVL 4114 Score = 22.6 bits (43), Expect(2) = 6.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +3 / -3 Query: 123 KWTNARPCNERALVLY 170 +W+N PC +R L ++ Sbjct: 408 RWSNNIPCIDRTLYIF 361
>LOC_Os11g31190:12011.t02719:unspliced-genomic mtN3-like protein, putative, expressed| Length = 2801 Score = 27.6 bits (54), Expect(2) = 6.7 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSA 75 ST+ P RC+PPSS+ S+ Sbjct: 1526 STSSTPPRRPRCSPPSSSSSS 1588 Score = 21.7 bits (41), Expect(2) = 6.7 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = +3 / +1 Query: 288 QCIHLYIKKKKK 323 +C+H Y+ ++KK Sbjct: 2419 ECVHAYMGRRKK 2454
>LOC_Os12g32330:12012.t02933:unspliced-genomic mpv17 / PMP22 family protein, expressed| Length = 5336 Score = 29.5 bits (58), Expect = 8.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 / +2 Query: 4 RVRSTTGPPTSATRCTPPSSTPSAP 78 RVR ++ PTSA +PP S P P Sbjct: 62 RVRPSSHGPTSAPTSSPPPSAPPPP 136
>LOC_Os12g16450:12012.t01498:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5427 Score = 29.5 bits (58), Expect = 8.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 / +2 Query: 16 TTGPPTSATRCTPPSSTPSAPLKWSV 93 TT +++ +PP TP A KWSV Sbjct: 4907 TTAKTWASSSASPPPPTPEAMAKWSV 4984
>LOC_Os11g29420:12011.t02547:unspliced-genomic lipid binding protein, putative| Length = 1169 Score = 29.5 bits (58), Expect = 8.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 / -2 Query: 13 STTGPPTSATRCTPPSSTPSAPLKW 87 S + P + C PP++TPS P W Sbjct: 148 SPSAGPGPSRTCPPPTATPSPPPPW 74
>LOC_Os11g25100:12011.t02129:unspliced-genomic tropinone reductase, putative, expressed| Length = 584 Score = 29.5 bits (58), Expect = 8.8 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 / -2 Query: 19 TGPPTSATRCTPPSSTPSAPLKW 87 + PP RC P S T AP +W Sbjct: 283 SAPPRYGRRCAPSSRTQRAPPRW 215
>LOC_Os10g39810:12010.t03224:unspliced-genomic C-4 methylsterol oxidase, putative, expressed| Length = 2964 Score = 29.5 bits (58), Expect = 8.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 / -2 Query: 4 RVRSTTGPPTSATRCTPPSSTPS 72 R RS PP++ T TPP S+PS Sbjct: 233 RGRSPGSPPST*TTATPPPSSPS 165
>LOC_Os10g39590:12010.t03202:unspliced-genomic NEDD8-like protein RUB2 precursor, putative| Length = 246 Score = 29.5 bits (58), Expect = 8.8 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 / -3 Query: 19 TGPPTSATRCTPPSSTPSA 75 + PP+ + RC+PP +PSA Sbjct: 85 SSPPSPSPRCSPPPPSPSA 29
>LOC_Os10g05690:12010.t00444:unspliced-genomic auxin transporter-like protein 3, putative, expressed| Length = 6214 Score = 29.5 bits (58), Expect = 8.8 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +1 / +2 Query: 28 PTSATRCTPPSSTPSA 75 PTS+TR TP +S+PSA Sbjct: 5600 PTSSTRSTPSASSPSA 5647
>LOC_Os09g39370:12009.t03402:unspliced-genomic conserved hypothetical protein| Length = 1988 Score = 29.5 bits (58), Expect = 8.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 / -2 Query: 25 PPTSATRCTPPSSTPSAP 78 PP S+ RC+PP P +P Sbjct: 751 PPPSSRRCSPPPPRPESP 698
>LOC_Os09g37790:12009.t03253:unspliced-genomic S-locus-specific glycoprotein S13 precursor, putative, expressed| Length = 5581 Score = 29.5 bits (58), Expect = 8.8 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 / +2 Query: 1 ARVRSTTGPPTSATRCTPPSSTP 69 AR RST T TR TPPS +P Sbjct: 4685 ARRRSTPPSSTPTTRSTPPSPSP 4753
>LOC_Os09g26660:12009.t02345:unspliced-genomic calcium ion binding protein, putative, expressed| Length = 10941 Score = 29.5 bits (58), Expect = 8.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 / -1 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 R+T PPT A PP +PS P Sbjct: 2106 RTTAPPPTPAASSPPPPPSPSPP 2038
>LOC_Os09g20090:12009.t01743:unspliced-genomic L-ascorbate oxidase precursor, putative, expressed| Length = 5281 Score = 29.5 bits (58), Expect = 8.8 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 / +2 Query: 10 RSTTGPPTSATRCTPPSSTPSAP 78 R T PPT++ R +PPS T P Sbjct: 4283 RRGTTPPTASARASPPSRTRRTP 4351
>LOC_Os08g18110:12008.t01681:unspliced-genomic alpha-soluble NSF attachment protein, putative, expressed| Length = 5553 Score = 29.5 bits (58), Expect = 8.8 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTP 69 ST PPTS+TR PSS+P Sbjct: 221 STRTPPTSSTRGPTPSSSP 277
>LOC_Os08g04350:12008.t00330:unspliced-genomic uclacyanin-2 precursor, putative, expressed| Length = 933 Score = 29.5 bits (58), Expect = 8.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 / +2 Query: 25 PPTSATRCTPPSSTPSAPL 81 PPT+ R TPPSS+ S P+ Sbjct: 641 PPTNGGRPTPPSSSASKPV 697
>LOC_Os08g01260:12008.t00026:unspliced-genomic VQ motif family protein| Length = 624 Score = 29.5 bits (58), Expect = 8.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 / +2 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 S++G +S+T C P SSTP+ P Sbjct: 128 SSSGSRSSSTPCRPRSSTPTPP 193
>LOC_Os07g49330:12007.t04561:unspliced-genomic phosphoinositide-specific phospholipase C, putative, expressed| Length = 3157 Score = 29.5 bits (58), Expect = 8.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 / +3 Query: 13 STTGPPTSATRCTPPSSTPSAP 78 +TT PP S T + P++TP++P Sbjct: 657 TTTWPPRSPTTSSTPATTPTSP 722
>LOC_Os07g48880:12007.t04516:unspliced-genomic importin alpha-1b subunit, putative, expressed| Length = 4587 Score = 29.5 bits (58), Expect = 8.8 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 / +3 Query: 28 PTSATRCTPPSSTPSAP 78 PT+ T +PPSS PS+P Sbjct: 279 PTTTTATSPPSSAPSSP 329
>LOC_Os07g43990:12007.t04041:unspliced-genomic expressed protein| Length = 2328 Score = 29.5 bits (58), Expect = 8.8 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +1 / +1 Query: 25 PPTSATRCTPPSSTPSAP 78 PP+ A+ TPPSS+P+ P Sbjct: 442 PPSPASSPTPPSSSPTTP 495 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 129,893,918 Number of extensions: 1930001 Number of successful extensions: 18631 Number of sequences better than 10.0: 292 Length of query: 108 Length of database: 55,613,886 Length adjustment: 46 Effective length of query: 62 Effective length of database: 53,025,098 Effective search space: 3287556076 Effective search space used: 3287556076 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
