| Clone Name | FLbaf137l17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q9UL36:ZN236_HUMAN Zinc finger protein 236 - Homo sapiens (Human) | 32 | 2.7 | 2 | Q9DA19:CIR_MOUSE CBF1-interacting corepressor - Mus musculus (Mo... | 31 | 3.5 | 3 | P25304:AGRIN_RAT Agrin precursor - Rattus norvegicus (Rat) | 31 | 4.6 |
|---|
>Q9UL36:ZN236_HUMAN Zinc finger protein 236 - Homo sapiens (Human)| Length = 1845 Score = 31.6 bits (70), Expect = 2.7 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -1 Query: 475 EVAGLRYHVCEHKSMEFKIPNDSLRH 398 E G+R+HVC + + EF+ P+D +RH Sbjct: 475 EENGVRWHVCPYCAKEFRKPSDLVRH 500
>Q9DA19:CIR_MOUSE CBF1-interacting corepressor - Mus musculus (Mouse)| Length = 450 Score = 31.2 bits (69), Expect = 3.5 Identities = 22/88 (25%), Positives = 42/88 (47%), Gaps = 2/88 (2%) Frame = -1 Query: 589 LLHPRHAKGHSTQNKSRTQTKFPRKSKQTDGS-W-HAAGSEVAGLRYHVCEHKSMEFKIP 416 +L+ + HS + K++ + +FP++ + S W H+A + H E K + Sbjct: 331 MLYEELSSSHSDRGKAQEKLRFPKQESSGENSMWVHSASDRTSRSHRHSPEKKGSD---R 387 Query: 415 NDSLRHTSPRHRAKAHRTENGQMQYRKQ 332 N +R S R RA++ R + YR++ Sbjct: 388 NRGIRSRS-RSRAESSRRSRSRSPYRQK 414
>P25304:AGRIN_RAT Agrin precursor - Rattus norvegicus (Rat)| Length = 1959 Score = 30.8 bits (68), Expect = 4.6 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +2 Query: 62 PRLDPS*LFMCRVYPAPTLICFSCPVSSVLGLKLQLFAANMRRGIY 199 PR +P + R + P IC +S LG + LF +N + GI+ Sbjct: 10 PRQEPGASMLVRYFMIPCNICLILLATSTLGFAVLLFLSNYKPGIH 55 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 121,543,179 Number of extensions: 2831155 Number of successful extensions: 6983 Number of sequences better than 10.0: 3 Number of HSP's gapped: 6980 Number of HSP's successfully gapped: 3 Length of query: 218 Length of database: 100,686,439 Length adjustment: 109 Effective length of query: 109 Effective length of database: 70,788,284 Effective search space: 7715922956 Effective search space used: 7715922956 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)