ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf126j02 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os05g08554:12005.t004720:unspliced-genomic expressed protein| Length = 2656 Score = 65.2 bits (136), Expect = 3e-10 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +3 / +3 Query: 72 KMYNAPSGQEMSYTDHVQKRHEEKGCIYA 158 KMYN PS QEM+Y DHVQ+RHEEKGC+YA Sbjct: 183 KMYNPPSAQEMTYKDHVQRRHEEKGCLYA 269 Score = 35.0 bits (70), Expect = 0.35 Identities = 18/30 (60%), Positives = 19/30 (63%) Frame = -2 / -1 Query: 160 HA*MQPFSSWRFWTWSV*DISCPDGALYIL 71 HA QPFSSWR T S+ IS G LYIL Sbjct: 271 HAYKQPFSSWRL*T*SLYVISWALGGLYIL 182
>LOC_Os01g08300:12001.t00708:unspliced-genomic expressed protein| Length = 973 Score = 63.4 bits (132), Expect = 1e-09 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +3 / +3 Query: 69 AKMYNAPSGQEMSYTDHVQKRHEEKGCIYA 158 A MYN P+ QEMSY+DHV+KRHE+KGC+YA Sbjct: 96 AAMYNPPAAQEMSYSDHVKKRHEDKGCLYA 185 Score = 57.0 bits (118), Expect = 8e-08 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -2 / -1 Query: 160 HA*MQPFSSWRFWTWSV*DISCPDGALYILAKGGS 56 HA* QP SSWRF TWS *DISC G LYI A+ + Sbjct: 187 HA*RQPLSSWRFLTWSE*DISCAAGGLYIAARAAA 83 Score = 33.6 bits (67), Expect = 0.89 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 / -2 Query: 159 MRRCSPSPRGASGRGPCRTSPAPMERYTS 73 M R S P GAS G RTSPAP E TS Sbjct: 186 MHRGSLCPHGAS*HGRSRTSPAPPEGCTS 100
>LOC_Os06g05120:12006.t00401:unspliced-genomic expressed protein| Length = 2326 Score = 62.9 bits (131), Expect = 1e-09 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +3 / +2 Query: 72 KMYNAPSGQEMSYTDHVQKRHEEKGCIYA 158 KMYNAP Q+MSY +HVQ+RHEEKGC+YA Sbjct: 1328 KMYNAPMAQDMSYYEHVQRRHEEKGCLYA 1414 Score = 60.6 bits (126), Expect = 7e-09 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +3 / +1 Query: 69 AKMYNAPSGQEMSYTDHVQKRHEEKGCIYA 158 AKMYN P+ Q+MSY DH KRHEEKGC+YA Sbjct: 94 AKMYNPPAQQDMSYYDHCTKRHEEKGCLYA 183 Score = 49.6 bits (102), Expect = 1e-05 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -2 / -2 Query: 160 HA*MQPFSSWRFWTWSV*DISCPDGALYILA 68 HA* QPFSSWR T S *D+SC GALYIL+ Sbjct: 1416 HA*RQPFSSWRLCTCS**DMSCAIGALYILS 1324 Score = 41.8 bits (85), Expect = 0.003 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -3 / -3 Query: 159 MRRCSPSPRGASGRGPCRTSPAPMERYTS 73 M R +PSP GAS RT P P+ERYTS Sbjct: 1415 MHRGNPSPHGASAHVHSRTCPVPLERYTS 1329 Score = 39.1 bits (79), Expect = 0.020 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = -2 / -3 Query: 160 HA*MQPFSSWRFWTWSV*DISCPDGALYILAKGGS 56 HA* QPFSS R S *D+SC G LYILA S Sbjct: 185 HA*RQPFSSCRLVQ*S**DMSCCAGGLYILASFSS 81 Score = 33.1 bits (66), Expect = 1.2 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = +2 / +1 Query: 71 QDV*RSIGAGDVLHGPRPEAPRGEGLHLRM 160 QDV*RS G G VL EAP GEGL L M Sbjct: 1327 QDV*RSNGTGHVLL*TCAEAP*GEGLPLCM 1416 Score = 32.7 bits (65), Expect = 1.7 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 / -1 Query: 159 MRRCSPSPRGASGRGPCRTSPAPMERYTSW 70 MRR SPSP A RT PA E TSW Sbjct: 184 MRRGSPSPHAAWCSDRSRTCPAAPEGCTSW 95
>LOC_Os03g27460:12003.t02422:unspliced-genomic heat shock protein binding protein, putative, expressed| Length = 4138 Score = 37.7 bits (76), Expect = 0.051 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = -3 / -2 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMW 43 AP T R P+PRGAS R P PAP +R R + W Sbjct: 180 APRTACTRRGPAPRGASRRSPATAPPAPSPTRRRRRRCRRRSPW 49
>LOC_Os02g11770:12002.t00976:unspliced-genomic expressed protein| Length = 970 Score = 36.8 bits (74), Expect = 0.097 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +3 / +2 Query: 96 QEMSYTDHVQKRHEEKGCIYA 158 Q++S +HV+KRHEEKG +YA Sbjct: 167 QKLSAMEHVKKRHEEKGFLYA 229
>LOC_Os08g26310:12008.t02397:unspliced-genomic conserved hypothetical protein| Length = 1332 Score = 35.9 bits (72), Expect = 0.18 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -3 / -3 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGR 55 RR SPS S CR P+P+ R W+R GR Sbjct: 289 RRASPSCHRTSPPNRCRHRPSPLRRRRIWERRGR 188
>LOC_Os08g06790:12008.t00569:unspliced-genomic hypothetical protein| Length = 1955 Score = 33.1 bits (66), Expect(2) = 0.31 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 / -2 Query: 150 CSPSPRGASGRGPCRTSPAPMER 82 C+PSP +G GP R PAP +R Sbjct: 1531 CAPSPPPMTGAGPRRIPPAPTQR 1463 Score = 22.1 bits (42), Expect(2) = 0.31 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -2 / -1 Query: 280 CCALRPPSMEA 248 CC +PPS+ A Sbjct: 1847 CCQFQPPSLRA 1815
>LOC_Os03g42770:12003.t03678:unspliced-genomic expressed protein| Length = 6589 Score = 35.0 bits (70), Expect = 0.35 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -3 / +3 Query: 147 SPSPRGASGRGPCRTSPAPMERYTSWQRV 61 SPSP GA+G RTS A + +WQR+ Sbjct: 261 SPSPSGAAGAAATRTSRARTATWRAWQRL 347
>LOC_Os04g10360:12004.t00869:unspliced-genomic xylem serine proteinase 1 precursor, putative, expressed| Length = 2426 Score = 28.1 bits (55), Expect(2) = 0.38 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 / +2 Query: 114 PCRTSPAPMERYTSWQRVGRVTMWKKSPRVVLC 16 PCR S P R + R T W+ S LC Sbjct: 1316 PCRASATPTARRSRRTSTPRRTPWRASASPALC 1414 Score = 27.2 bits (53), Expect(2) = 0.38 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 / +2 Query: 156 RRCSPSPRGASGRGPCRTSPAP 91 RRCSP RGA SP+P Sbjct: 788 RRCSPPRRGAPSSTASTCSPSP 853
>LOC_Os09g02250:12009.t00125:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 3301 Score = 29.9 bits (59), Expect(2) = 0.39 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -3 / +3 Query: 162 RMRRCSPSPRGASGRGPCRTSPAPMER 82 R RR S +PR A+ P SPAP R Sbjct: 1011 RSRRTSAAPRCATSTSPPTASPAPSRR 1091 Score = 22.1 bits (42), Expect(2) = 0.39 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -1 / +2 Query: 50 LCGRSLQGLCSA 15 LCGR L LC++ Sbjct: 1217 LCGRPLDSLCAS 1252
>LOC_Os06g49120:12006.t04596:unspliced-genomic nmrA-like family protein, expressed| Length = 4227 Score = 34.5 bits (69), Expect = 0.47 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +1 / -3 Query: 325 LVS*LDERNCSIRCCYYNTICPGQDYHCNHPSWFVLHLNSIQHQKKKKN 471 L+S*++ + NT P + Y C+HPS +L L + + KN Sbjct: 2374 LIS*MEAQASDHTAWLLNTTYPTKSYFCSHPSKVLLALGGVSQRTSLKN 2228
>LOC_Os01g59050:12001.t05297:unspliced-genomic cytochrome P450 94A1, putative| Length = 1553 Score = 34.5 bits (69), Expect = 0.47 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -3 / +2 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSPR 28 +P TR RR SP RGP +P+ R +SW+ R + +PR Sbjct: 590 SPSTRTRRASPRRGWGRTRGPSSCAPSTTRRTSSWRGSCRRSSGHGAPR 736
>LOC_Os09g04050:12009.t00301:unspliced-genomic dihydroflavonol-4-reductase, putative, expressed| Length = 3153 Score = 34.1 bits (68), Expect = 0.65 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -3 / -1 Query: 171 P*TRMRRCSPSPRGASGRGPCRTSPAP 91 P R R P+P G S R PC SP+P Sbjct: 2418 PALRSRTSWPTPSGTSSRAPCSRSPSP 2338
>LOC_Os06g36170:12006.t03314:unspliced-genomic tRNA A64-2-O-ribosylphosphate transferase, putative, expressed| Length = 3967 Score = 34.1 bits (68), Expect = 0.65 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 / +1 Query: 156 RRCSPSPRGASGRGPCRTSPAP 91 RRC SP A+G G CR +P+P Sbjct: 232 RRCRWSPTSAAGSGTCRPAPSP 297
>LOC_Os05g34000:12005.t02995:unspliced-genomic POT family protein, expressed| Length = 2832 Score = 34.1 bits (68), Expect = 0.65 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 / +2 Query: 147 SPSPRGASGRGPCRTSPAPMERYTSW 70 S SPR R PCRT+PA SW Sbjct: 881 SSSPRSRRSRSPCRTTPASSTTTRSW 958
>LOC_Os05g26630:12005.t02318:unspliced-genomic expressed protein| Length = 759 Score = 34.1 bits (68), Expect = 0.65 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 / -1 Query: 150 CSPSPRGASGRGPCRTSPAPMER 82 C P PRGA+ PC PAP+ R Sbjct: 489 CRPLPRGANPESPCCPFPAPLPR 421
>LOC_Os09g38620:12009.t03330:unspliced-genomic NADPH--cytochrome P450 reductase, putative, expressed| Length = 5859 Score = 33.6 bits (67), Expect = 0.89 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 / -2 Query: 162 RMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGR 55 R + P + GRGP +PAP R W+ GR Sbjct: 470 RRGQARPPASSSRGRGPAAAAPAPSRRARRWRSGGR 363
>LOC_Os09g15330:12009.t01322:unspliced-genomic sugar transport protein 14, putative, expressed| Length = 4006 Score = 33.6 bits (67), Expect = 0.89 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 / +1 Query: 147 SPSPRGASGRGPCRTSPAPMERYTSWQRVG 58 +P PR +S R CR P R+ W+R G Sbjct: 2671 APPPRSSSARCSCRRRPTASSRWGGWRRRG 2760
>LOC_Os06g45340:12006.t04221:unspliced-genomic FKBP-type peptidyl-prolyl cis-trans isomerase 4, chloroplast| precursor, putative, expressed Length = 1385 Score = 33.6 bits (67), Expect = 0.89 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = -3 / -2 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQRVG 58 RR P PRGA GRG RT+ P R +R G Sbjct: 337 RRTLPPPRGARGRGWMRTARRPRPRAGGGRRRG 239
>LOC_Os06g18670:12006.t01690:unspliced-genomic anthocyanidin 3-O-glucosyltransferase, putative, expressed| Length = 1783 Score = 33.6 bits (67), Expect = 0.89 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 / +1 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSW 70 RRCSPS R A R R +P P +R W Sbjct: 805 RRCSPSARTAPWRARRRRAPPPTQRGRRW 891
>LOC_Os05g50650:12005.t04495:unspliced-genomic ligA, putative, expressed| Length = 1558 Score = 33.6 bits (67), Expect = 0.89 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 / +1 Query: 144 PSPRGASGRGPCRTSPAPMERYTSWQRVG 58 P PRGA GR + P P R +W+R G Sbjct: 649 PRPRGARGR*GAQRGPPPWRRSRAWRRRG 735
>LOC_Os03g55260:12003.t04790:unspliced-genomic cytochrome P450 81E1, putative, expressed| Length = 2118 Score = 33.6 bits (67), Expect = 0.89 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 / -3 Query: 150 CSPSPRGASGRGPCRTSPAPMERYTSWQR 64 CSP PR + R RT+ AP T W R Sbjct: 784 CSPPPRSCASRRTRRTTGAPASNPTGWPR 698
>LOC_Os01g54470:12001.t04864:unspliced-genomic anther-specific proline-rich protein APG, putative, expressed| Length = 2186 Score = 33.6 bits (67), Expect = 0.89 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = -3 / -3 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGR 55 AP R R P PR A+ RT+PAP R GR Sbjct: 309 APAARRPRARPRPREAAAEAAARTTPAPFPAAALDARAGR 190
>LOC_Os01g43610:12001.t03876:unspliced-genomic ovate protein, putative, expressed| Length = 1493 Score = 33.6 bits (67), Expect = 0.89 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -3 / +2 Query: 165 TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQR 64 TR RR + RGA RG T P P R+ W+R Sbjct: 773 TRTRRRAARRRGARRRGSPATRPTPSGRWYPWRR 874
>LOC_Os02g16770:12002.t01470:unspliced-genomic hypothetical protein| Length = 2420 Score = 31.8 bits (63), Expect(2) = 0.92 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 / -3 Query: 141 SPRGASGRGPCRTSPA 94 SPR +GRGPCR PA Sbjct: 1149 SPRRCNGRGPCRNPPA 1102 Score = 22.1 bits (42), Expect(2) = 0.92 Identities = 5/16 (31%), Positives = 11/16 (68%) Frame = -3 / -1 Query: 78 TSWQRVGRVTMWKKSP 31 T+W+R + +W++ P Sbjct: 92 TAWKRTTLMAVWRRRP 45
>LOC_Os12g30990:12012.t02805:unspliced-genomic F-box domain containing protein| Length = 939 Score = 33.1 bits (66), Expect = 1.2 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -3 / -3 Query: 171 P*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGR 55 P R RRCS P A PCR S +P R ++ GR Sbjct: 343 PTGRSRRCSSRPWRAPPPSPCRCSRSPGRRRSTTAATGR 227
>LOC_Os06g44040:12006.t04092:unspliced-genomic DOMON domain containing protein, expressed| Length = 2966 Score = 33.1 bits (66), Expect = 1.2 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 / -2 Query: 135 RGASGRGPCRTSPAPMERYTSWQRVGRVTMWK 40 R SGRG R PAP R W+R R W+ Sbjct: 1390 RACSGRGARRAPPAPPARPRPWRRRRRRPRWR 1295
>LOC_Os05g04830:12005.t00377:unspliced-genomic expressed protein| Length = 2200 Score = 33.1 bits (66), Expect = 1.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 / -1 Query: 141 SPRGASGRGPCRTSPAP 91 S RGA GRGPCR P P Sbjct: 664 SRRGAPGRGPCRRGPPP 614
>LOC_Os04g52290:12004.t04705:unspliced-genomic EMB2217, putative, expressed| Length = 2968 Score = 33.1 bits (66), Expect = 1.2 Identities = 19/52 (36%), Positives = 21/52 (40%) Frame = -3 / +2 Query: 162 RMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSPRVVLCSAL 7 R RC PSP S P SP P +S GR + SP L S L Sbjct: 338 RSPRCRPSPIRLSSSSPRPPSPPPTPPRSSPSSPGRASSHGSSPPTTLSSLL 493
>LOC_Os01g67450:12001.t06102:unspliced-genomic triacylglycerol lipase, putative| Length = 1284 Score = 33.1 bits (66), Expect = 1.2 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 / -3 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVT 49 RR +PRG +GRG CR S + R +R G T Sbjct: 754 RRTGGTPRGGAGRGSCRRSRSAASRRRRCRR*GTPT 647
>LOC_Os11g39150:12011.t03458:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3416 Score = 31.8 bits (63), Expect(2) = 1.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 / +2 Query: 147 SPSPRGASGRGPCRTSPAP 91 +PSPRGAS R P PAP Sbjct: 3287 TPSPRGASPRSPITAPPAP 3343 Score = 22.1 bits (42), Expect(2) = 1.2 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = -3 / +2 Query: 297 GGRWVSAAPCGHLPWRPW 244 G RW A G WR W Sbjct: 2948 GRRWQRRAEGGGWDWRGW 3001 Score = 30.4 bits (60), Expect = 8.3 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 / -3 Query: 92 GAGDVLHGPRPEAPRGEGL 148 GAG + G R EAPRGEG+ Sbjct: 3342 GAGGAVIGDRGEAPRGEGV 3286
>LOC_Os11g41000:12011.t03639:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2248 Score = 32.7 bits (65), Expect = 1.7 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -3 / -3 Query: 162 RMRRCSPSPRGASGRGPCRTSPAPMER 82 R R SP+PR AS GP SPAP ++ Sbjct: 278 RHRVSSPAPRAASP*GPAAQSPAPYKK 198
>LOC_Os11g34390:12011.t02992:unspliced-genomic glycosyltransferase 6, putative, expressed| Length = 1499 Score = 32.7 bits (65), Expect = 1.7 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 / +1 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQR 64 RRC+ S RG+ C +S R TSW R Sbjct: 820 RRCTASARGSGSTPACSSSATASGRSTSWTR 912 Score = 25.8 bits (50), Expect(2) = 3.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 / -3 Query: 244 PWPPWKVAARRSRDPPTSAA 303 P PPW V+ RR+ P S A Sbjct: 60 PMPPWPVSPRRTELPLYSRA 1 Score = 25.4 bits (49), Expect(2) = 3.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 / -1 Query: 104 VLHGPRPEAPRGEGLHLRMRVH 169 V H P P R G H R RVH Sbjct: 968 VEHAPPPGVLRRGGAHARPRVH 903 Score = 30.4 bits (60), Expect = 8.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 / -3 Query: 162 RMRRCSPSPRGASGRGPCR 106 R R C P GA GR PCR Sbjct: 807 RRRGCDPCTCGAGGRSPCR 751
>LOC_Os10g01560:12010.t00052:unspliced-genomic BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor,| putative, expressed Length = 3466 Score = 32.7 bits (65), Expect = 1.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 / -2 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQ 67 AP R P+P G+ R P PAP R +SW+ Sbjct: 2034 APPCTRTRTLPAPAGSPPRTPTSPPPAPRTRRSSWR 1927
>LOC_Os09g39260:12009.t03392:unspliced-genomic prephenate dehydratase, putative, expressed| Length = 4048 Score = 32.7 bits (65), Expect = 1.7 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -3 / -3 Query: 153 RCSPSPRGASGRGPCRTSPAPMERYTSWQR 64 RC+P RG PCRTS P TS R Sbjct: 740 RCAPGTRGCMSARPCRTSWWPRHSSTSTTR 651
>LOC_Os04g59620:12004.t005539:unspliced-genomic TATA-binding protein-associated factor MOT1, putative, expressed| Length = 5292 Score = 32.7 bits (65), Expect = 1.7 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +2 / -3 Query: 401 ITVIIHHGSCCILIQFSIKKKK 466 +T +IH +CCIL+ +I+KKK Sbjct: 3688 LTFVIHTITCCILVPINIQKKK 3623
>LOC_Os04g44320:12004.t03972:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 4543 Score = 32.7 bits (65), Expect = 1.7 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -3 / +2 Query: 141 SPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSPR 28 SPR S C TS +P ++WQ R W+ S R Sbjct: 3869 SPRCPSTASRCATSSSPRRSPSTWQGTWRQARWRGSSR 3982
>LOC_Os03g02800:12003.t00169:unspliced-genomic ANAC086, putative, expressed| Length = 4538 Score = 32.7 bits (65), Expect = 1.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 / +1 Query: 123 GRGPCRTSPAPMERYTSWQRVGRVTMWKK 37 G PCR + E+Y S VGRV WK+ Sbjct: 2473 GAPPCRATSMDDEQYRSLPNVGRVV*WKR 2559
>LOC_Os02g18620:12002.t01655:unspliced-genomic hypothetical protein| Length = 975 Score = 32.7 bits (65), Expect = 1.7 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 / +2 Query: 244 PWPPWKVAARRSRDPPTSAA 303 P+PPW R S PPTSA+ Sbjct: 188 PYPPWATTTRCSAGPPTSAS 247 Score = 26.3 bits (51), Expect(2) = 1.9 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -3 / -3 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQR 64 RR RG SGRG C + R W R Sbjct: 97 RRGRTGRRGPSGRGRCGSRTRAAARRRRWSR 5 Score = 23.5 bits (45), Expect(2) = 1.9 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = -3 / -3 Query: 303 GSGGRWVSAAPCGHLPWR 250 G RW A C PWR Sbjct: 247 GCRRRWPGRAACRRRPWR 194
>LOC_Os01g47730:12001.t04219:unspliced-genomic ras-related protein Rab11B, putative, expressed| Length = 1599 Score = 32.7 bits (65), Expect = 1.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 / +1 Query: 147 SPSPRGASGRGPCRTSPAPMER 82 +PSPR GR P RT P+P R Sbjct: 1105 APSPRRTPGRSPRRTGPSPWRR 1170
>LOC_Os01g35789:12001.t006883:unspliced-genomic expressed protein| Length = 3006 Score = 32.7 bits (65), Expect = 1.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 / +1 Query: 147 SPSPRGASGRGPCRTSPAPMER 82 +PSPR +GR C +PAP+ R Sbjct: 391 TPSPRPQTGRSACTAAPAPVHR 456
>LOC_Os01g25386:12001.t02255:unspliced-genomic multidrug resistance-associated protein 4, putative, expressed| Length = 17314 Score = 32.7 bits (65), Expect = 1.7 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -3 / +3 Query: 144 PSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSP 31 P P S R PC TSP+P R + V+ K +P Sbjct: 6093 PPPSSRSSRSPCATSPSPSSRSPRPWSLSAVSTRKPTP 6206 Score = 30.9 bits (61), Expect = 6.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 / -1 Query: 162 RMRRCSPSPRGASGRGPCRTSPAPME 85 R R +P P G + R CR+ P+P++ Sbjct: 10696 RCRSTTPPPSGVTARVRCRSQPSPLD 10619
>LOC_Os07g12370:12007.t01109:unspliced-genomic expressed protein| Length = 3918 Score = 31.8 bits (63), Expect(2) = 1.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 / -1 Query: 253 PWKVAARRSRDPPTSAAFHNKHM 321 PWK AR+ ++PP H H+ Sbjct: 2748 PWKAVARKGKEPPPPHTTHRHHL 2680 Score = 21.7 bits (41), Expect(2) = 1.9 Identities = 6/22 (27%), Positives = 14/22 (63%) Frame = +1 / -3 Query: 403 HCNHPSWFVLHLNSIQHQKKKK 468 +C HP V S++H+++++ Sbjct: 1300 NCRHPQDPVERRGSVEHRQRRR 1235
>LOC_Os11g14220:12011.t01254:unspliced-genomic tubulin alpha-3 chain, putative, expressed| Length = 2885 Score = 27.2 bits (53), Expect(2) = 1.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 / +3 Query: 83 RSIGAGDVLHGPRPEAPRGEGL 148 R G G VL GPR GEGL Sbjct: 2433 RGHGGGGVLRGPRGPRRAGEGL 2498 Score = 25.8 bits (50), Expect(2) = 1.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 / +2 Query: 352 CSIRCCYYNTICPGQDYHCNHPS 420 CS RCC +C +H +PS Sbjct: 2702 CSFRCCDLCCLCEPSLWHL*YPS 2770
>LOC_Os10g26320:12010.t02044:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 270 Score = 26.7 bits (52), Expect(2) = 2.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 / -1 Query: 403 HCNHPSWFVLHLNSIQHQKKK 465 +C++ S L+ NS+QHQ+ K Sbjct: 129 YCDNVSAMYLYSNSVQHQRTK 67 Score = 21.7 bits (41), Expect(2) = 2.1 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +2 / -1 Query: 281 ETHRPPLPFTISICD 325 E H PP T+ CD Sbjct: 165 ELHSPPSTMTLVYCD 121
>LOC_Os06g35320:12006.t03229:unspliced-genomic exopolygalacturonase precursor, putative, expressed| Length = 1665 Score = 28.6 bits (56), Expect(2) = 2.2 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 / +3 Query: 165 TRMRRCSPSPRGASGRGPCRTSPAPMER 82 TR + +PR S P RTSPAP R Sbjct: 1149 TRSALPTATPRSPSRTSPSRTSPAPPPR 1232 Score = 23.5 bits (45), Expect(2) = 2.2 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -3 / +1 Query: 291 RWVSAAPCGHLPWRPW 244 RW S+ PC W W Sbjct: 52 RWGSSVPCSCWRWCAW 99
>LOC_Os06g35370:12006.t03234:unspliced-genomic exopolygalacturonase precursor, putative, expressed| Length = 1682 Score = 28.6 bits (56), Expect(2) = 2.2 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 / +1 Query: 165 TRMRRCSPSPRGASGRGPCRTSPAPMER 82 TR + +PR S P RTSPAP R Sbjct: 1153 TRSALPTATPRSPSRTSPSRTSPAPPPR 1236 Score = 23.5 bits (45), Expect(2) = 2.2 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -3 / +2 Query: 291 RWVSAAPCGHLPWRPW 244 RW S+ PC W W Sbjct: 56 RWGSSVPCSCWRWCAW 103
>LOC_Os11g46000:12011.t04125:unspliced-genomic von Willebrand factor type A domain containing protein, expressed| Length = 3870 Score = 32.2 bits (64), Expect = 2.3 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 / +1 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTSPAP 91 AP T RRC+ SP G P T+P P Sbjct: 1780 APRTTRRRCASSPSGLRAPTPSSTTPTP 1863
>LOC_Os09g26500:12009.t02329:unspliced-genomic serine hydrolase, putative, expressed| Length = 2654 Score = 32.2 bits (64), Expect = 2.3 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -3 / -3 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKK 37 RRC P RGA RG + P R R R T W++ Sbjct: 1794 RRCKPRARGAPARGGNPRTRRPPRRERRATRRSRGTSWRR 1675
>LOC_Os08g28790:12008.t02635:unspliced-genomic dirigent-like protein pDIR3, putative, expressed| Length = 802 Score = 32.2 bits (64), Expect = 2.3 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 / -3 Query: 162 RMRRCSPSPRGASGRGPCRTSPAP 91 R RRCS P R PCR +PAP Sbjct: 311 RRRRCSGPP*RGRPRPPCRRTPAP 240
>LOC_Os08g11150:12008.t00997:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 9755 Score = 32.2 bits (64), Expect = 2.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 / +2 Query: 4 EESRAEHNPWRLLPHSNPTHPLPR 75 EE H WRLLPH P PR Sbjct: 1271 EEFAGSHRGWRLLPHRLPERSTPR 1342
>LOC_Os07g37550:12007.t03424:unspliced-genomic chlorophyll a-b binding protein of LHCII type III, chloroplast| precursor, putative, expressed Length = 1333 Score = 32.2 bits (64), Expect = 2.3 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -3 / +3 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMW 43 RRCS S ++ R PC + PAP T+ W Sbjct: 558 RRCSRSGCASTSRSPCGSRPAPRSSPTAASTTSATPTW 671
>LOC_Os06g15370:12006.t01410:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 4592 Score = 32.2 bits (64), Expect = 2.3 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = -3 / +2 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSP 31 AP RR S P G+ G T+P R T+W R R T +P Sbjct: 911 APSRGSRRWSSPPSGSGGCRRTPTTPRRCTRTTTWTRPSRSTASSSTP 1054
>LOC_Os05g08810:12005.t00758:unspliced-genomic phosphatidylinositol 3-kinase, root isoform, putative, expressed| Length = 11505 Score = 32.2 bits (64), Expect = 2.3 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -3 / +1 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTSPAP 91 AP +R R S SP+ GRG C T P P Sbjct: 202 APASRKSRTSASPKQGPGRGWCWTPPPP 285
>LOC_Os02g03100:12002.t00210:unspliced-genomic NADP-dependent D-sorbitol-6-phosphate dehydrogenase, putative,| expressed Length = 2906 Score = 32.2 bits (64), Expect = 2.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 / -3 Query: 303 GSGGRWVSAAPCGHLPWR 250 G+ GRW+S++PC WR Sbjct: 2598 GTSGRWISSSPCPRRRWR 2545
>LOC_Os01g41050:12001.t03627:unspliced-genomic sulfate transporter 3.5, putative, expressed| Length = 3228 Score = 28.6 bits (56), Expect(2) = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 / +3 Query: 16 AEHNPWRLLPHSNPTH 63 AEH WRLLPH H Sbjct: 1368 AEHGSWRLLPHLPRLH 1415 Score = 24.0 bits (46), Expect(2) = 2.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 / +3 Query: 253 PWKVAARRSRDPPTSAA 303 PW A RSR P T+A+ Sbjct: 2919 PWPRAGTRSRAPSTAAS 2969
>LOC_Os07g32600:12007.t02942:unspliced-genomic glucan endo-1,3-beta-glucosidase 3 precursor, putative, expressed| Length = 5878 Score = 25.8 bits (50), Expect(2) = 3.0 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 / +3 Query: 13 RAEHNPWRLLPHSNPTHPLPRC 78 R H P + P HP+PRC Sbjct: 828 RGPHRAPLRAPRAPPGHPVPRC 893 Score = 23.1 bits (44), Expect(2) = 3.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / +3 Query: 95 AGDVLHGPRPEAPR 136 AG V+H P P PR Sbjct: 999 AGQVVHSPAPLPPR 1040
>LOC_Os02g46120:12002.t04199:unspliced-genomic regulatory protein, putative, expressed| Length = 4796 Score = 28.1 bits (55), Expect(2) = 3.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 / -1 Query: 25 NPWRLLPHSNPTHPLPRCITLH 90 NP + + H +PTHP P ++H Sbjct: 2807 NPIQTVLHLHPTHPSPLAASIH 2742 Score = 24.9 bits (48), Expect(2) = 3.0 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 / -1 Query: 352 CSIRCCYYN 378 CSI+CC YN Sbjct: 1157 CSIQCCQYN 1131
>LOC_Os04g03410:12004.t00231:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4137 Score = 26.3 bits (51), Expect(2) = 3.0 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 / -3 Query: 340 DERNCSIRCCYYNTICP 390 ++R C+ +CC +T CP Sbjct: 2062 NQRGCADKCCAPSTTCP 2012 Score = 22.6 bits (43), Expect(2) = 3.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 / -3 Query: 247 WPPWKVAARRSRDP 288 WPP +RRSR P Sbjct: 2179 WPPLIGCSRRSRGP 2138
>LOC_Os10g32730:12010.t02581:unspliced-genomic haloacid dehalogenase-like hydrolase domain-containing protein 1A,| putative, expressed Length = 4695 Score = 31.8 bits (63), Expect = 3.2 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 / -1 Query: 156 RRCSPSPRGASGRGPCRTSPA 94 RRC+P P GA G G RTS A Sbjct: 249 RRCTPHPPGAPGGGEDRTSEA 187
>LOC_Os09g37270:12009.t03201:unspliced-genomic pollen-specific kinase partner protein, putative, expressed| Length = 3917 Score = 31.8 bits (63), Expect = 3.2 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 / -1 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQRV 61 R SPSP S P ++PA R T W R+ Sbjct: 842 RAASPSPSSTSPSSPKPSAPASTARRTQWLRI 747
>LOC_Os09g36550:12009.t03131:unspliced-genomic armadillo/beta-catenin-like repeat family protein, expressed| Length = 3574 Score = 31.8 bits (63), Expect = 3.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 / -1 Query: 144 PSPRGASGRGPCRTSPAPMERYTSW 70 PS G++ RG C + P+P +TSW Sbjct: 958 PSSPGSTPRGCCSSCPSPRNVWTSW 884
>LOC_Os08g39660:12008.t03698:unspliced-genomic cytochrome P450 76C4, putative, expressed| Length = 1667 Score = 31.8 bits (63), Expect = 3.2 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 / +2 Query: 165 TRMRRCSPSPRGASGRGPCRTSPA 94 TR R SPS GAS R CRTS A Sbjct: 290 TRRGRRSPSTTGASRRARCRTSAA 361
>LOC_Os07g36600:12007.t03330:unspliced-genomic USP family protein, putative, expressed| Length = 3886 Score = 31.8 bits (63), Expect = 3.2 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -3 / +2 Query: 162 RMRRCSPSPRGASGRGPCR 106 R RRCS SPRG S R P R Sbjct: 305 RRRRCSRSPRGCSSRPPRR 361
>LOC_Os07g33100:12007.t02990:unspliced-genomic uncharacterized ACR, COG1590 family protein, expressed| Length = 6171 Score = 31.8 bits (63), Expect = 3.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 / -3 Query: 144 PSPRGASGRGPCRTSPAPMERYTSWQRVGR 55 P P G GRG C + P SW R GR Sbjct: 301 PGPPGPRGRGRCTPTRRPAPSSWSWPRRGR 212
>LOC_Os06g08810:12006.t00760:unspliced-genomic expressed protein| Length = 1974 Score = 31.8 bits (63), Expect = 3.2 Identities = 17/45 (37%), Positives = 20/45 (44%) Frame = -3 / -3 Query: 162 RMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSPR 28 R RR P R A+GR PCRT R R R + W+ R Sbjct: 715 RRRRRRPRRRPAAGRRPCRTRGGRRGRRRWSGRTTRGSPWRSGRR 581
>LOC_Os04g36040:12004.t03274:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 5132 Score = 31.8 bits (63), Expect = 3.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 / +3 Query: 156 RRCSPSPRGASGRGPCRTSPAP 91 R +P+PR AS R CR SP P Sbjct: 4206 RSAAPAPRSASRRRRCRPSPTP 4271
>LOC_Os04g33820:12004.t03058:unspliced-genomic F-box domain containing protein, expressed| Length = 1299 Score = 31.8 bits (63), Expect = 3.2 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -3 / -3 Query: 171 P*TRMRRCSPSPRGASGRGPCRTSPAP 91 P R R SP PR A G P R+SP P Sbjct: 229 PRGRARATSPGPRRAPGAPPWRSSPPP 149
>LOC_Os03g24730:12003.t02165:unspliced-genomic expressed protein| Length = 3609 Score = 31.8 bits (63), Expect = 3.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 / +3 Query: 162 RMRRCSPSPRGASGRGPCRTSPAP 91 R R C SP A R CR SPAP Sbjct: 1662 RPRWCPSSPASARTRSACRASPAP 1733
>LOC_Os03g16334:12003.t01418:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 4996 Score = 31.8 bits (63), Expect = 3.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 / -1 Query: 162 RMRRCSPSPRGASGRGPCRTSPA 94 R R CS P G GR PCR P+ Sbjct: 820 RGRTCSARPPGCPGRTPCRRHPS 752
>LOC_Os02g50350:12002.t04619:unspliced-genomic dihydropyrimidine dehydrogenase precursor, putative, expressed| Length = 4036 Score = 31.8 bits (63), Expect = 3.2 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -3 / +3 Query: 162 RMRRCSPSPRGASGRGPCRTSPAPMER 82 R RRC+ SP G + R P PAP R Sbjct: 117 RPRRCAASPGGGTRRCPSAPPPAPASR 197
>LOC_Os02g42290:12002.t03814:unspliced-genomic ATP-dependent Clp protease proteolytic subunit, putative, expressed| Length = 2504 Score = 31.8 bits (63), Expect = 3.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 / +2 Query: 165 TRMRRCSPSPRGASGRGPCRTSPAPMERYTS 73 T R SPRG+ PC TS AP R S Sbjct: 518 TSTPRAGSSPRGSRSTTPCSTSAAPSPRSAS 610
>LOC_Os02g02500:12002.t00149:unspliced-genomic DNA binding protein, putative, expressed| Length = 3971 Score = 31.8 bits (63), Expect = 3.2 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 / +1 Query: 244 PWPPWKVAARRSRDPPTSAAFH 309 P PPW +A RSR PP + H Sbjct: 118 PPPPWSTSASRSRSPPRYVSGH 183
>LOC_Os05g22614:12005.t01921:unspliced-genomic expressed protein| Length = 5962 Score = 29.9 bits (59), Expect(2) = 3.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 / -2 Query: 367 CYYNTICPGQDYHCNHPSWFVLHLNSI 447 C +T Q+Y CN PS +LH +SI Sbjct: 1080 CNLDTYRNAQNYECNEPSCRLLHHHSI 1000 Score = 23.1 bits (44), Expect(2) = 3.6 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 / -1 Query: 268 ARRSRDPPTSAAFHNKH 318 A S +PP HNKH Sbjct: 2986 ALNSDEPPRDGRVHNKH 2936
>LOC_Os07g42420:12007.t03894:unspliced-genomic 3-oxoacyl-synthase I, chloroplast precursor, putative, expressed| Length = 5660 Score = 26.3 bits (51), Expect(2) = 4.0 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -3 / +1 Query: 153 RCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVT 49 RC SPRG+S R P R A T+ + T Sbjct: 325 RCPRSPRGSSPRAPRRRRNAAAPTSTTTTTISSST 429 Score = 22.1 bits (42), Expect(2) = 4.0 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = -3 / +1 Query: 267 GHLPWRPW 244 G L WRPW Sbjct: 301 GDLQWRPW 324
>LOC_Os09g25730:12009.t02252:unspliced-genomic transposon protein, putative, unclassified| Length = 1800 Score = 25.8 bits (50), Expect(2) = 4.3 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 / -2 Query: 316 AYCERQRRSVGLCCA 272 A+C R RR G CC+ Sbjct: 1598 AHCRRCRRGCGCCCS 1554 Score = 22.6 bits (43), Expect(2) = 4.3 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = -3 / -2 Query: 171 P*TRMRRCSPSPRGASGRGPCRTSPAPMER 82 P R R P+ + GP TSP R Sbjct: 1514 PRRRTRTAPPAASRPAATGPASTSPTACSR 1425
>LOC_Os12g39400:12012.t03620:unspliced-genomic zinc-finger protein 1, putative, expressed| Length = 1214 Score = 31.3 bits (62), Expect = 4.4 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -3 / -3 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMW 43 AP R RR P+P + R P +SP P R W+ W Sbjct: 585 APSRRRRRRRPTPTRTASR*PPVSSPPPPRRRRPWRAAAASGGW 454
>LOC_Os12g07110:12012.t00596:unspliced-genomic acyl-CoA synthetase long-chain family member 3, putative, expressed| Length = 5508 Score = 31.3 bits (62), Expect = 4.4 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +2 / +1 Query: 11 AEQSTTLGDFFHIVTRPTLCQDV*RSIGAGDVLHGPRPEAPRGEGL 148 ++Q T DF + +P ++V S+ +LH PRP G L Sbjct: 4603 SQQGVTYTDFVDLCQKPEAVKEVLGSLSKVCILHSPRPSIM*GASL 4740
>LOC_Os11g17970:12011.t01570:unspliced-genomic POT family protein, expressed| Length = 6696 Score = 31.3 bits (62), Expect = 4.4 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -3 / -1 Query: 171 P*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRV 52 P R S S R P RTSPAP + W+R R+ Sbjct: 4662 PPRRSGTAPASAGSGSTRAPSRTSPAPPRSWRRWRRRRRL 4543
>LOC_Os10g03320:12010.t00221:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 1488 Score = 31.3 bits (62), Expect = 4.4 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 / +2 Query: 150 CSPSPRGASGRGPCRTSPAPMERYTSWQ 67 C SPR A+ R R +P P TSW+ Sbjct: 128 CPSSPRRATSRASRRCAPPPRRASTSWR 211
>LOC_Os09g24850:12009.t02166:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6306 Score = 31.3 bits (62), Expect = 4.4 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +1 / +2 Query: 379 TICPGQDYHCNHPSWFVLHLNSIQHQ 456 +ICP ++ PSWF+LH +S++ Q Sbjct: 536 SICPIILHYVASPSWFLLHRDSVEWQ 613
>LOC_Os08g10649:12008.t00947:unspliced-genomic GTP-binding protein ERG, putative, expressed| Length = 8709 Score = 31.3 bits (62), Expect = 4.4 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -3 / +1 Query: 162 RMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSPR 28 R RR + SPR S ++ AP R + + VG W++S R Sbjct: 295 RSRRATRSPRSGSSGSTPPSARAPTRRCSGRRGVGWTMRWRRSGR 429
>LOC_Os07g39510:12007.t03612:unspliced-genomic protein yippee-like OJ1003C07.11, putative, expressed| Length = 3356 Score = 31.3 bits (62), Expect = 4.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 / +1 Query: 144 PSPRGASGRGPCRTSPAP 91 PSP GA G GP SPAP Sbjct: 160 PSPAGAWGSGPIAASPAP 213
>LOC_Os05g43880:12005.t03877:unspliced-genomic gibberellin 2-beta-dioxygenase, putative, expressed| Length = 1758 Score = 31.3 bits (62), Expect = 4.4 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 / -3 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQ 67 +P R R C + R A RGP SPAP +W+ Sbjct: 613 SPRRRRRPCRRARRAAPRRGPPPPSPAPSSPSPAWR 506
>LOC_Os04g24130:12004.t02128:unspliced-genomic conserved hypothetical protein| Length = 3308 Score = 31.3 bits (62), Expect = 4.4 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -3 / -3 Query: 165 TRMRRCSPSPRGASGRGPCRTSPAPMER 82 TR R +PS R SGR P R PAP +R Sbjct: 2964 TRPRHRTPSRRCPSGR*PPRWPPAPRQR 2881
>LOC_Os04g08660:12004.t00734:unspliced-genomic hypothetical protein| Length = 441 Score = 31.3 bits (62), Expect = 4.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 / -3 Query: 348 PLIELRH*SHMLIVKGSGGRWVSAAPCG 265 PLI RH +++V G+GGRW + G Sbjct: 340 PLILRRHWETLVVVDGAGGRWRRSCSLG 257
>LOC_Os03g14010:12003.t01193:unspliced-genomic hydrolase, hydrolyzing O-glycosyl compounds, putative, expressed| Length = 3371 Score = 31.3 bits (62), Expect = 4.4 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -3 / +2 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMW 43 RRCS + + R PCR S R W+ GR W Sbjct: 2174 RRCSRTS*SGTLRSPCRGSCGSTCRTRCWRSCGRTA*W 2287
>LOC_Os03g08410:12003.t00698:unspliced-genomic monooxygenase/ oxidoreductase, putative, expressed| Length = 3022 Score = 31.3 bits (62), Expect = 4.4 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 / -1 Query: 156 RRCSPSPRGASGRGPCRTSPAP 91 RRC+ SPR GR P SP P Sbjct: 175 RRCAASPRTPPGRAPPAASPPP 110
>LOC_Os01g40240:12001.t03550:unspliced-genomic hypothetical protein| Length = 1587 Score = 31.3 bits (62), Expect = 4.4 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 / +3 Query: 104 VLHGPRPEAPRGEGLHLRMRVHGA 175 V H PRG GLH R R+H A Sbjct: 714 VQHAAARRLPRGHGLHRRQRIHHA 785
>LOC_Os01g26990:12001.t02403:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3067 Score = 31.3 bits (62), Expect = 4.4 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = -3 / +3 Query: 162 RMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSPRVVL 19 R RR P+PR G P R +P R ++ + V SPR+ L Sbjct: 1668 RARRPGPTPRATFGTSPLRGTPPSSARRSAGRAVRHPYRGGSSPRLPL 1811
>LOC_Os04g45060:12004.t04041:unspliced-genomic MYB14, putative| Length = 1399 Score = 26.3 bits (51), Expect(2) = 4.5 Identities = 14/48 (29%), Positives = 17/48 (35%) Frame = -3 / -3 Query: 171 P*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSPR 28 P R S PR + G G C +P R R W+ PR Sbjct: 1145 PSARTCGTSHRPRSSRGAGRCPAAPRRRRPRLWTTRTRRQRRWRSRPR 1002 Score = 24.4 bits (47), Expect(2) = 4.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 / -2 Query: 282 SAAPCGHLPWRPW 244 +A G+ PWRPW Sbjct: 1356 TAGNSGNPPWRPW 1318
>LOC_Os02g32140:12002.t02857:unspliced-genomic AP2 domain transcription factor, putative, expressed| Length = 1407 Score = 25.8 bits (50), Expect(2) = 4.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 / -3 Query: 247 WPPWKVAARRSRDPPTSAA 303 WP + RR R PP SAA Sbjct: 1249 WPQCRPRRRRRRRPPRSAA 1193 Score = 24.9 bits (48), Expect(2) = 4.5 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 / -1 Query: 368 ATIIPSVPDKTITVIIHHGSCCILIQFSIKKK 463 AT++P +T + H C+L F+ KKK Sbjct: 891 ATVVPLRRRRTCSQAHAHVQNCVLPPFAFKKK 796
>LOC_Os02g07850:12002.t00681:unspliced-genomic conserved hypothetical protein| Length = 2909 Score = 28.6 bits (56), Expect(2) = 4.7 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 / -3 Query: 288 WVSAAPCGHLPWRPW 244 W A CG L WRPW Sbjct: 2118 WRCRAWCGGLSWRPW 2074 Score = 23.1 bits (44), Expect(2) = 4.7 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 / -2 Query: 147 SPSPRGASGRGPCRTSPAP 91 SPS R +SG G P P Sbjct: 85 SPSSRSSSGHGTSSRPPPP 29
>LOC_Os12g40720:12012.t03751:unspliced-genomic hypothetical protein| Length = 3266 Score = 28.6 bits (56), Expect(2) = 5.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 / -3 Query: 321 HMLIVKGSGGRWVSAAPCGHLPWR 250 +M + GG V+A+ C H PWR Sbjct: 441 NMEVPNDPGGGAVAASSCAHRPWR 370 Score = 23.1 bits (44), Expect(2) = 5.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 / -1 Query: 56 GLLCGRSLQGLC 21 GLLCGR G C Sbjct: 215 GLLCGRRCGGAC 180
>LOC_Os09g20550:12009.t01789:unspliced-genomic inhibitor of apoptosis, putative, expressed| Length = 4788 Score = 24.4 bits (47), Expect(2) = 5.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 / +3 Query: 104 HLLPRWSVIHLGKGWVGLLC 45 HLLP + + L K +VGL C Sbjct: 2295 HLLPYFYLCALNKYFVGLAC 2354 Score = 23.5 bits (45), Expect(2) = 5.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 / +2 Query: 62 WVGLLCGRSLQGL 24 W+GLLC S+ GL Sbjct: 2342 WIGLLCPCSVLGL 2380
>LOC_Os04g08070:12004.t00680:unspliced-genomic expressed protein| Length = 2024 Score = 24.4 bits (47), Expect(2) = 5.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 / -2 Query: 250 PPWKVAARRSRDP 288 PPW+ ARRS P Sbjct: 703 PPWRTPARRSSCP 665 Score = 23.5 bits (45), Expect(2) = 5.8 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +1 / -1 Query: 382 ICPGQDYHCNHPSWFVLH 435 +C Y C H SW L+ Sbjct: 578 VCVNVPYGCGHDSWSPLY 525
>LOC_Os12g44240:12012.t04090:unspliced-genomic BGGP Beta-1-3-galactosyl-O-glycosyl-glycoprotein, putative,| expressed Length = 2279 Score = 30.9 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 / +2 Query: 13 RAEHNPWRLLPHSNPTHPLPRC 78 RA P R LP P HP PRC Sbjct: 353 RAPPRPPRALPPQEPLHPPPRC 418
>LOC_Os11g43040:12011.t03834:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2752 Score = 30.9 bits (61), Expect = 6.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 / +3 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTS 100 AP T RRCS +PR PC T+ Sbjct: 2637 APATTWRRCSATPRWRPSTAPCSTT 2711
>LOC_Os11g41600:12011.t03696:unspliced-genomic expressed protein| Length = 1928 Score = 30.9 bits (61), Expect = 6.0 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 / -3 Query: 174 AP*TRMRRCSPSPRGASGR 118 +P R RRCSPSP A GR Sbjct: 1473 SPCHRRRRCSPSPASAGGR 1417
>LOC_Os11g04990:12011.t00392:unspliced-genomic expressed protein| Length = 2893 Score = 30.9 bits (61), Expect = 6.0 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 / -1 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGR 55 RR +P P A R PC TSP +R GR Sbjct: 169 RRRTPPPSAADPRSPCSTSPCFSRSIPLLRRQGR 68
>LOC_Os10g42060:12010.t03434:unspliced-genomic ribosome inactivating protein, expressed| Length = 1187 Score = 30.9 bits (61), Expect = 6.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 / -2 Query: 153 RCSPSPRGASGRGPCRTSPAPM 88 R PSPR +SG P T+P P+ Sbjct: 694 RARPSPRRSSGSSPAPTAPPPL 629
>LOC_Os09g38768:12009.t03344:unspliced-genomic cell division control protein 50, putative, expressed| Length = 2620 Score = 30.9 bits (61), Expect = 6.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 / +2 Query: 162 RMRRCSPSPRGASGRGPCRTSPAP 91 R R C P P G+ GR P +P P Sbjct: 2027 RSRWCCPPPGGSEGRTPSSAAPTP 2098
>LOC_Os09g37520:12009.t03226:unspliced-genomic expressed protein| Length = 5975 Score = 30.9 bits (61), Expect = 6.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 / +1 Query: 162 RMRRCSPSPRGASGRGPCRTSPAP 91 R R CSPSP + R P T P P Sbjct: 514 RGRSCSPSPSATATRSPTPTVPTP 585
>LOC_Os09g24990:12009.t02180:unspliced-genomic CCR4-NOT transcription complex subunit 7, putative, expressed| Length = 3242 Score = 30.9 bits (61), Expect = 6.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 / -2 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTSPAPMER 82 +P TR R C P+PRG+ R R +P R Sbjct: 319 SPRTRPRGCPPTPRGSPPRRASRRPASPSAR 227
>LOC_Os09g21710:12009.t01905:unspliced-genomic AN1-type zinc finger protein 2B, putative, expressed| Length = 883 Score = 30.9 bits (61), Expect = 6.0 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 / -1 Query: 162 RMRRCSPSPRGASGRGP 112 R RRC P PR A RGP Sbjct: 253 RRRRCGPGPRRARSRGP 203
>LOC_Os08g33082:12008.t04252:unspliced-genomic DNA-repair protein complementing XP-C cells, putative, expressed| Length = 7198 Score = 30.9 bits (61), Expect = 6.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 / +2 Query: 171 P*TRMRRCSPSPRGASGRGPCRTSPAPM 88 P R R +P+ R SGR PCR +P P+ Sbjct: 272 PPRRRRCRNPAFRFVSGRPPCRRNPPPL 355
>LOC_Os08g25560:12008.t02323:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2030 Score = 30.9 bits (61), Expect = 6.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 / -2 Query: 156 RRCSPSPRGASGRGP 112 RRC+ SPR A+GRGP Sbjct: 208 RRCAVSPRPAAGRGP 164
>LOC_Os08g17330:12008.t01603:unspliced-genomic hypothetical protein| Length = 1791 Score = 30.9 bits (61), Expect = 6.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 / -1 Query: 150 CSPSPRGASGRGPCRTSPAPMER 82 C PSP +G GP R PAP R Sbjct: 438 CIPSPPPLTGAGPRRIPPAPTRR 370
>LOC_Os07g42140:12007.t03869:unspliced-genomic catalytic/ hydrolase, putative, expressed| Length = 2079 Score = 30.9 bits (61), Expect = 6.0 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 / +2 Query: 244 PWPPWKVAARRSRDPPTSA 300 P PPW+ ARR RD P A Sbjct: 530 PAPPWRRRARRGRDAPAHA 586
>LOC_Os07g27340:12007.t02428:unspliced-genomic no apical meristem protein| Length = 1914 Score = 30.9 bits (61), Expect = 6.0 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -3 / -3 Query: 156 RRCSPSPRGASGRGPCRTSPAPMER 82 RRCS +PR S P T+PAP R Sbjct: 1849 RRCS*APRQCSPGNPNHTTPAPPRR 1775
>LOC_Os07g01090:12007.t00009:unspliced-genomic proline transporter, putative, expressed| Length = 4426 Score = 30.9 bits (61), Expect = 6.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 / -2 Query: 77 HLGKGWVGLLCGRSLQGLCS 18 H K WV LLC LQGL S Sbjct: 2790 HHNKSWVSLLCSLYLQGLAS 2731
>LOC_Os05g40700:12005.t03609:unspliced-genomic transmembrane protein 56, putative, expressed| Length = 3774 Score = 30.9 bits (61), Expect = 6.0 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 / -2 Query: 53 TRPTLCQDV*RSIGAGDVLHGPRPEAPRGEGLHLRMR 163 T+ +C D S+GAG L P + P E +H R R Sbjct: 3539 TQVLICLDALTSVGAGHGLDHPLADLPEPEEVHRRHR 3429
>LOC_Os04g56370:12004.t05108:unspliced-genomic hypothetical protein| Length = 270 Score = 30.9 bits (61), Expect = 6.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -3 / +2 Query: 150 CSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMW 43 C PR S R CR P R +S R R T W Sbjct: 47 CCSPPRARSRRAHCRPRPRRRRRLSSSGRGARSTWW 154
>LOC_Os04g47250:12004.t04252:unspliced-genomic cytochrome P450 86A2, putative, expressed| Length = 2343 Score = 30.9 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 / -3 Query: 165 TRMRRCSPSPRGASGRGPCRT 103 T R SP+ RG + RGPCRT Sbjct: 967 TPRRSRSPAGRGRASRGPCRT 905
>LOC_Os04g40730:12004.t03634:unspliced-genomic steroid dehydrogenase SPM2, putative, expressed| Length = 3358 Score = 30.9 bits (61), Expect = 6.0 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 / +3 Query: 95 AGDVLHGPRPEAPRGEGLHLRMRV 166 AG L G + EAP+G G HLR R+ Sbjct: 372 AGRGLRGDQGEAPQGRGPHLRARL 443 Score = 30.4 bits (60), Expect = 8.3 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 / -1 Query: 165 TRMRRCSPSPRGASGRGPCRTSPA 94 +R RRC P P GAS P R PA Sbjct: 442 SRARRCGPRPWGASP*SPRRPRPA 371
>LOC_Os04g37720:12004.t03342:unspliced-genomic expressed protein| Length = 2572 Score = 30.9 bits (61), Expect = 6.0 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -3 / -2 Query: 171 P*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSPR 28 P +R R + GA+GR P P+ R +W R R+ + PR Sbjct: 348 PTSRAPRSRSASPGAAGRRGFSGRPRPLPRPRAWPRPPRIPRRHRQPR 205
>LOC_Os04g22120:12004.t01943:unspliced-genomic protein kinase, putative, expressed| Length = 5504 Score = 30.9 bits (61), Expect = 6.0 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = -3 / -1 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWK 40 RRC R A GP R R SW+R+ R W+ Sbjct: 632 RRC*CRRRRAGRSGPTRPCACRTRRRRSWRRLRRCPWWR 516
>LOC_Os04g07740:12004.t00648:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2741 Score = 30.9 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 / +2 Query: 153 RCSPSPRGASGRGPCRTSP 97 +CSP PR + R PC +SP Sbjct: 2093 QCSPRPRESQARNPCISSP 2149
>LOC_Os03g40070:12003.t03438:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 3947 Score = 30.9 bits (61), Expect = 6.0 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 / -1 Query: 135 RGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSP 31 R + R CR S +P R+TS R R + W +SP Sbjct: 3440 RSPACRRSCRPSCSPARRWTSPSRGCRRSRWPRSP 3336
>LOC_Os03g16450:12003.t01428:unspliced-genomic pentatricopeptide repeat protein PPR868-14, putative, expressed| Length = 2497 Score = 30.9 bits (61), Expect = 6.0 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = -3 / +2 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSPRVVLCSA 10 R SP PR + +SPAP T W+R G + + R +A Sbjct: 362 RTPSPPPRSLTCTPSAASSPAPARCSTKWRRAGTRSSGTRCSRATRATA 508
>LOC_Os03g11420:12003.t00942:unspliced-genomic non-cyanogenic beta-glucosidase precursor, putative, expressed| Length = 7061 Score = 30.9 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 / +2 Query: 253 PWKVAARRSRDPPTSAAFH 309 PWK+ +RS PP AA H Sbjct: 1064 PWKIPRKRSEPPPPPAAVH 1120
>LOC_Os02g54110:12002.t04990:unspliced-genomic nodulin-like protein, putative, expressed| Length = 7203 Score = 30.9 bits (61), Expect = 6.0 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / +3 Query: 147 SPSPRGASGRGPCRTSPAP 91 +P PRG GRGP R AP Sbjct: 246 APGPRGGRGRGPARLRRAP 302
>LOC_Os02g15250:12002.t01318:unspliced-genomic mucin-associated surface protein, putative, expressed| Length = 1672 Score = 30.9 bits (61), Expect = 6.0 Identities = 16/48 (33%), Positives = 19/48 (39%) Frame = -3 / +3 Query: 171 P*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSPR 28 P R R +P PR + P RT P R W R T + PR Sbjct: 516 PRPRAPRTTPRPRAPRPKTPARTPRRPRRRRRRWPRGRPPTTPDRPPR 659
>LOC_Os01g51370:12001.t06755:unspliced-genomic expressed protein| Length = 1909 Score = 30.9 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 / -3 Query: 141 SPRGASGRGPCRTSPAPME 85 +P GA G PCR P P+E Sbjct: 371 APNGAGGGAPCRLPPRPLE 315
>LOC_Os01g33020:12001.t02872:unspliced-genomic trafficking protein particle complex subunit 1, putative, expressed| Length = 3048 Score = 30.9 bits (61), Expect = 6.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 / +1 Query: 153 RCSPSPRGASGRGPCRTSPAPMER 82 RCSPS G R CRT P P R Sbjct: 118 RCSPSAAGRR*RRWCRTRPRPRRR 189
>LOC_Os01g29409:12001.t02629:unspliced-genomic SAM binding motif, putative, expressed| Length = 13973 Score = 30.9 bits (61), Expect = 6.0 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 / +2 Query: 244 PWPPWKVAARRSRDPPT 294 PWPP ++A+R R PPT Sbjct: 407 PWPPPQLASRAQRRPPT 457
>LOC_Os01g18780:12001.t01669:unspliced-genomic fibroin heavy chain precursor, putative| Length = 2030 Score = 30.9 bits (61), Expect = 6.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 / -2 Query: 156 RRCSPSPRGASGRGPCRTSPAPM 88 R CSP+ +G PCR PAP+ Sbjct: 1537 RSCSPALLPLTGSAPCRPLPAPL 1469
>LOC_Os01g07800:12001.t00660:unspliced-genomic thiol-disulphide oxidoreductase DCC, putative, expressed| Length = 1352 Score = 30.9 bits (61), Expect = 6.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 / -2 Query: 244 PWPPWKVAARRSRDPPTSAA 303 PWPP + A RRS PP A+ Sbjct: 184 PWPPSRTAHRRSPPPPQPAS 125
>LOC_Os01g06560:12001.t00539:unspliced-genomic tumor-related protein, putative, expressed| Length = 1721 Score = 30.9 bits (61), Expect = 6.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 / -2 Query: 144 PSPRGASGRGPCRTSPAP 91 PSP AS R PC +SP+P Sbjct: 946 PSPARASSRPPCSSSPSP 893
>LOC_Os10g39730:12010.t03214:unspliced-genomic hypothetical protein| Length = 999 Score = 24.0 bits (46), Expect(2) = 6.1 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 / +2 Query: 171 P*TRMRRCSPS 139 P TR RRCSPS Sbjct: 428 PTTRTRRCSPS 460 Score = 24.0 bits (46), Expect(2) = 6.1 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 / +2 Query: 153 RCSPSPRGASGRGPCRTSPAP 91 R SP + RGP SPAP Sbjct: 518 RTRSSPPRSGRRGPTTASPAP 580
>LOC_Os02g52850:12002.t04865:unspliced-genomic ATP binding protein, putative, expressed| Length = 3111 Score = 28.6 bits (56), Expect(2) = 6.7 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 / +3 Query: 171 P*TRMRRCSPSPRGASGRGPCRT 103 P T R S SP GAS R PCRT Sbjct: 618 PPTCSCRRSGSPSGASWRRPCRT 686 Score = 22.6 bits (43), Expect(2) = 6.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 / +3 Query: 310 CERQRRSVGLCCALRPP 260 C R RR G+ C+L P Sbjct: 141 CARHRRCGGIRCSLSSP 191
>LOC_Os02g41720:12002.t03759:unspliced-genomic transposon protein, putative, Mutator sub-class, expressed| Length = 8905 Score = 26.7 bits (52), Expect(2) = 6.8 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 / +3 Query: 366 TSDTTVPLIELRH*SHMLIVKGSGGRWVSAAPCGHL 259 T + P I+ RH SH+ V+G+ A CG L Sbjct: 2082 TPELLDPAIDHRHRSHLTAVQGAQLGTFQARTCGDL 2189 Score = 25.8 bits (50), Expect(2) = 6.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 / +2 Query: 147 SPSPRGASGRGPCRTSPAPMERYT 76 SPS G + R CRT P+ R T Sbjct: 4709 SPSQLGGARRCRCRTRRRPLRRQT 4780
>LOC_Os11g26080:12011.t02224:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6526 Score = 25.4 bits (49), Expect(3) = 7.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 / -1 Query: 244 PWPPWKVAARRSRDPPTSAAFHNKH 318 P PP A R PPTSA F H Sbjct: 976 PPPPRARALVRGTSPPTSAPFPPPH 902 Score = 23.1 bits (44), Expect(3) = 7.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 / -2 Query: 8 RAEQSTTLGDFFHI 49 R+EQ +TLG FH+ Sbjct: 5298 RSEQLSTLGAHFHV 5257 Score = 22.1 bits (42), Expect(3) = 7.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 / -1 Query: 43 PHSNPTHPLPRCITLH 90 PHS LP CI H Sbjct: 3745 PHSTTATTLPPCIPSH 3698
>LOC_Os05g23980:12005.t02055:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2727 Score = 25.8 bits (50), Expect(2) = 8.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 / -1 Query: 86 SIGAGDVLHGPRPEAPRGEGLHLRMRVHGA 175 ++GA +H P R + + R+R+HGA Sbjct: 432 ALGANVEVHAPEHRLLRSDRGNHRLRIHGA 343 Score = 24.9 bits (48), Expect(2) = 8.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 / -1 Query: 22 HNPWRLLPHSNPTHPL 69 H+ WRL P HPL Sbjct: 1512 HDQWRLRPRRRHCHPL 1465
>LOC_Os01g08170:12001.t00695:unspliced-genomic expressed protein| Length = 3916 Score = 27.2 bits (53), Expect(2) = 8.2 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 / +3 Query: 171 P*TRMRRCSPSPRGASGRGPCRTSPAP 91 P T R S SPR +S G CR AP Sbjct: 2928 PSTASSRSSSSPRSSSRSGWCRRCGAP 3008 Score = 24.0 bits (46), Expect(2) = 8.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 / +1 Query: 304 RQRRSVGLCCALRPPSMEAMD 242 R+R+ VGL ALRP + A D Sbjct: 1042 RRRQPVGLGQALRPRQVPAAD 1104
>LOC_Os12g41240:12012.t03801:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 1123 Score = 30.4 bits (60), Expect = 8.3 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 / -1 Query: 165 TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQ 67 TR C P P +S R P R P P+ R S Q Sbjct: 445 TRGPTCHPQPPASSNRRPRRPLPPPIPRLPSSQ 347
>LOC_Os12g03030:12012.t00196:unspliced-genomic conserved hypothetical protein| Length = 2534 Score = 30.4 bits (60), Expect = 8.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 / -3 Query: 301 QRRSVGLCCALRPPSMEA 248 ++R G CC LRPPS+ A Sbjct: 207 KQRHYGFCCLLRPPSVRA 154
>LOC_Os12g01950:12012.t00093:unspliced-genomic expressed protein| Length = 2836 Score = 30.4 bits (60), Expect = 8.3 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 / -3 Query: 162 RMRRCSPSPRGASGRGPCRTSPAPMER 82 R RR SP+ R +SGR P R P P R Sbjct: 359 RCRRRSPAWRRSSGRRPWRCPPPPPRR 279
>LOC_Os11g03290:12011.t00220:unspliced-genomic nucleoside-triphosphatase, putative, expressed| Length = 3902 Score = 30.4 bits (60), Expect = 8.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 / -2 Query: 301 QRRSVGLCCALRPPSMEA 248 ++R G CC LRPPS+ A Sbjct: 748 KQRHYGFCCLLRPPSVRA 695
>LOC_Os10g42754:12010.t03549:unspliced-genomic expressed protein| Length = 3284 Score = 30.4 bits (60), Expect = 8.3 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +1 / -1 Query: 37 LLPHSNPTHPLPRC 78 LLPHS P H LPRC Sbjct: 2855 LLPHSLPRHLLPRC 2814
>LOC_Os10g32760:12010.t02584:unspliced-genomic protein binding protein, putative, expressed| Length = 2403 Score = 30.4 bits (60), Expect = 8.3 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 / +3 Query: 165 TRMRRCSPSPRGASGRGPCRTSPAP 91 T RRC+PSPR + R P + P Sbjct: 1293 TTRRRCTPSPRSPAARSPSSRTRRP 1367
>LOC_Os10g21470:12010.t01635:unspliced-genomic expressed protein| Length = 6112 Score = 30.4 bits (60), Expect = 8.3 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -3 / -3 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGR 55 AP* R RRC RG GRG P R +R GR Sbjct: 254 AP*GRARRCGSPRRGPGGRGGAAAPPTRGGRGGWRRRGGR 135
>LOC_Os09g38410:12009.t03309:unspliced-genomic sialin, putative, expressed| Length = 4348 Score = 30.4 bits (60), Expect = 8.3 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 / +1 Query: 108 RTSPAPMERYTSWQRVGRVTMWKKSPRVVLC 16 RT+ RYTS R G + W K P +VLC Sbjct: 1546 RTTVKGQ*RYTSNTRFGAESFWIK*PHLVLC 1638
>LOC_Os09g37780:12009.t03252:unspliced-genomic serine/threonine-protein kinase receptor precursor, putative| Length = 3603 Score = 30.4 bits (60), Expect = 8.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 / +2 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMW 43 RR SP A+ G CR S +T GR T W Sbjct: 608 RRRGTSPSAATRTGRCRWSSGKARAFTGAPTHGRATWW 721
>LOC_Os09g15180:12009.t01308:unspliced-genomic transposon protein, putative, unclassified| Length = 4366 Score = 30.4 bits (60), Expect = 8.3 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = -3 / +3 Query: 147 SPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSP 31 SPSP +S G CR PA +W+ V R SP Sbjct: 4155 SPSPLPSSSPGGCRPRPASPPVAATWEAVRRRHRTPASP 4271
>LOC_Os08g39694:12008.t03701:unspliced-genomic cytochrome P450 76C2, putative, expressed| Length = 13081 Score = 30.4 bits (60), Expect = 8.3 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 / +2 Query: 162 RMRRCSPSPRGASGRGPCRTSPA 94 R R SPS GAS R CRT PA Sbjct: 11624 RRGRRSPSTTGASRRARCRTLPA 11692
>LOC_Os08g34580:12008.t03198:unspliced-genomic trehalose-6-phosphate synthase, putative, expressed| Length = 4007 Score = 30.4 bits (60), Expect = 8.3 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = -3 / +2 Query: 147 SPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKSPRVVLCSA 10 SP P ++ RTS AP SW +T SPR SA Sbjct: 656 SPPPSSSAPSPSARTSSAPSSTPISWASTPSITRATSSPRAPGSSA 793
>LOC_Os08g24550:12008.t02225:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2685 Score = 30.4 bits (60), Expect = 8.3 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 / -3 Query: 165 TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQ 67 TR C P P +S R P R P P+ R S Q Sbjct: 763 TRGPTCHPQPPASSNRRPRRPLPPPIPRLPSSQ 665
>LOC_Os08g15830:12008.t01457:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 11464 Score = 30.4 bits (60), Expect = 8.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 / -1 Query: 150 CSPSPRGASGRGPCRTSPA 94 C P PRGA+ PCRT+ A Sbjct: 4558 CPPPPRGAATDPPCRTAVA 4502
>LOC_Os06g49650:12006.t04649:unspliced-genomic harpin-induced protein, putative, expressed| Length = 1008 Score = 30.4 bits (60), Expect = 8.3 Identities = 18/47 (38%), Positives = 21/47 (44%) Frame = -3 / +3 Query: 174 AP*TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKS 34 AP T RR SPS RG G SPA R S R + ++S Sbjct: 414 APSTTWRRSSPSWRGTPTPGRTPPSPASTSRSASTAPTSRASAPRRS 554
>LOC_Os06g39970:12006.t03694:unspliced-genomic CESA11 - cellulose synthase| Length = 3210 Score = 30.4 bits (60), Expect = 8.3 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -3 / -1 Query: 153 RCSPSPRGASGRGPCRTSPAPMERYTSWQRVGRVTMWKKS 34 RCSPSP GA P R P + R R M ++S Sbjct: 687 RCSPSPAGAPSPRPPRRRTRPRPPAATPPRPSRTCMGRRS 568
>LOC_Os06g11450:12006.t01022:unspliced-genomic RING-H2 finger protein ATL3B precursor, putative, expressed| Length = 1816 Score = 30.4 bits (60), Expect = 8.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 / -2 Query: 162 RMRRCSPSPRGASGRGPCRTSPAPMERYTSW 70 R RR R R PCR AP R TSW Sbjct: 525 RRRRTR*GRRRTRARRPCRRRGAPSPRRTSW 433
>LOC_Os05g51510:12005.t04577:unspliced-genomic protein phosphatase 2C ABI2, putative, expressed| Length = 3591 Score = 30.4 bits (60), Expect = 8.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 / -2 Query: 385 CPGQDYHCNHPSWFVLHLNS 444 CPG++ H +H SW H+ S Sbjct: 1376 CPGREQHASHRSWLR*HVTS 1317
>LOC_Os04g57490:12004.t05215:unspliced-genomic cysteine protease 1 precursor, putative, expressed| Length = 1913 Score = 30.4 bits (60), Expect = 8.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 / -2 Query: 150 CSPSPRGASGRGPCRTSPAP 91 C+PS R R PCRT P P Sbjct: 1126 CAPSSRRRRWRRPCRTPPPP 1067
>LOC_Os04g52780:12004.t04752:unspliced-genomic leucine-rich repeat receptor protein kinase EXS precursor, putative,| expressed Length = 4340 Score = 30.4 bits (60), Expect = 8.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 / +1 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQR 64 R CS + G GR TSPA R SW R Sbjct: 2494 RSCSSATAGTGGRDVPPTSPATRRRPPSWCR 2586
>LOC_Os04g42090:12004.t03763:unspliced-genomic S-adenosylmethionine decarboxylase proenzyme, putative, expressed| Length = 3738 Score = 30.4 bits (60), Expect = 8.3 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 / -1 Query: 1 AEESRAEHNPWRLLPHSNPTHPLPR 75 A + H + L HS PTHPLPR Sbjct: 2832 ANRHQKSHLTHQTLHHSPPTHPLPR 2758
>LOC_Os03g43410:12003.t03736:unspliced-genomic OsIAA12 - Auxin-responsive Aux/IAA gene family member, expressed| Length = 1307 Score = 30.4 bits (60), Expect = 8.3 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -3 / -1 Query: 165 TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQRV 61 T R CSPSP P R PAP R W R+ Sbjct: 650 TAPRPCSPSPATRRWPPPPRRLPAPAPRSW*WARL 546
>LOC_Os03g26044:12003.t02298:unspliced-genomic CSLA5 - cellulose synthase-like family A; mannan synthase,| expressed Length = 5199 Score = 30.4 bits (60), Expect = 8.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 / -2 Query: 150 CSPSPRGASGRGPCRTSPAPMERYTSWQR 64 C+P+PR A+ P T+P P R T+ +R Sbjct: 401 CTPTPRPAAPAPPRATAPPPTPRATTRRR 315
>LOC_Os03g25150:12003.t02208:unspliced-genomic flavonoid 3,5-hydroxylase 2, putative, expressed| Length = 6514 Score = 30.4 bits (60), Expect = 8.3 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -3 / -2 Query: 156 RRCSPSPRGASGRGPCRTSPAPMERYTSWQRVGR 55 RR +P PR A+ GP R +P P R + GR Sbjct: 579 RRRTPPPRRAAAGGPRRGAPPPSRRARGRRAGGR 478
>LOC_Os03g17900:12003.t01564:unspliced-genomic catalytic/ hydrolase, putative, expressed| Length = 5270 Score = 30.4 bits (60), Expect = 8.3 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -3 / +3 Query: 165 TRMRRCSPSPRGASGRGPCRTSPAP 91 T RR SP+PR AS RG P P Sbjct: 420 TSPRRASPAPRTASSRGGSGAPPRP 494
>LOC_Os03g08790:12003.t00734:unspliced-genomic aspartic proteinase nepenthesin-1 precursor, putative, expressed| Length = 1752 Score = 30.4 bits (60), Expect = 8.3 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 / -1 Query: 174 AP*TRMRRCSPSPRGASGRGPCR 106 AP R R C+PSPRG R P R Sbjct: 1191 APGPRRRPCAPSPRGLRRRPPRR 1123
>LOC_Os03g03000:12003.t00186:unspliced-genomic DNA binding protein, putative, expressed| Length = 1163 Score = 30.4 bits (60), Expect = 8.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 / +1 Query: 150 CSPSPRGASGRGPCRTSPAP 91 C+PSP + PC TSP+P Sbjct: 1006 CAPSPPWRTSASPCCTSPSP 1065
>LOC_Os02g44654:12002.t05516:unspliced-genomic cytochrome P450 86A2, putative, expressed| Length = 2197 Score = 30.4 bits (60), Expect = 8.3 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 / -2 Query: 165 TRMRRCSPSPRGASGRGPCRT 103 TR RR SP+ + RGPCRT Sbjct: 768 TRRRRRSPASPWRASRGPCRT 706
>LOC_Os02g42310:12002.t03816:unspliced-genomic lysosomal protective protein precursor, putative, expressed| Length = 7255 Score = 30.4 bits (60), Expect = 8.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 / -1 Query: 244 PWPPWKVAARRSRDPPTSA 300 PWPPW +A RR R P A Sbjct: 4546 PWPPWALAYRRFRYFPRPA 4490
>LOC_Os01g55450:12001.t04957:unspliced-genomic CBL-interacting serine/threonine-protein kinase 11, putative,| expressed Length = 5053 Score = 30.4 bits (60), Expect = 8.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 / -2 Query: 123 GRGPCRTSPAPMERY 79 GR P RTSPAP RY Sbjct: 243 GRAPARTSPAPSPRY 199
>LOC_Os01g49090:12001.t04350:unspliced-genomic PE-PGRS family protein, putative| Length = 1759 Score = 30.4 bits (60), Expect = 8.3 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 / -3 Query: 165 TRMRRCSPSPRGASGRGPCRTSPAPMERYTSWQ 67 TR C P P +S R P R P P+ R S Q Sbjct: 1142 TRGPTCHPQPPASSNRRPRRPLPPPIPRLPSSQ 1044
>LOC_Os01g11590:12001.t01028:unspliced-genomic expressed protein| Length = 3478 Score = 30.4 bits (60), Expect = 8.3 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 / +3 Query: 162 RMRRCSPSPRGASGRGPCRTSPAPMERYTSWQR 64 R R P+P P R PAP R+ W R Sbjct: 300 RGARTGPAPPRTPPTSPARRKPAPARRWPRWAR 398
>LOC_Os01g09200:12001.t00797:unspliced-genomic serine/threonine-protein kinase 38, putative, expressed| Length = 9688 Score = 30.4 bits (60), Expect = 8.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 / -1 Query: 153 RCSPSPRGASGRGPCRTSPA 94 RC PSP G P RTSPA Sbjct: 6715 RCPPSPHGTRPHCPPRTSPA 6656
>LOC_Os10g37100:12010.t02982:unspliced-genomic cytochrome P450 89A2, putative| Length = 1539 Score = 28.1 bits (55), Expect(2) = 8.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 / -3 Query: 174 AP*TRMRRCSPSPRGASGRGPCRT 103 AP R SPS RGA R P RT Sbjct: 502 APPRRSPAASPSARGAPRRAPART 431 Score = 21.7 bits (41), Expect(2) = 8.8 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = -3 / -3 Query: 258 PWRPW 244 PWRPW Sbjct: 1204 PWRPW 1190
>LOC_Os03g10810:12003.t00882:unspliced-genomic HLS1, putative, expressed| Length = 1624 Score = 25.8 bits (50), Expect(2) = 9.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 / -3 Query: 4 EESRAEHNPWRLLPHSNPT 60 + S H+PWR LP S+ T Sbjct: 1040 KRSAPRHSPWRHLPSSSMT 984 Score = 24.0 bits (46), Expect(2) = 9.2 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 / -2 Query: 340 DERNCSIRCCY 372 D RN +RCCY Sbjct: 552 DTRNDQVRCCY 520
>LOC_Os12g36890:12012.t03369:unspliced-genomic CSLD4 - cellulose synthase-like family D, expressed| Length = 4436 Score = 23.5 bits (45), Expect(2) = 9.8 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -3 / -1 Query: 312 IVKGSGGRWVSAAPCGHLPWRP 247 + SG R ++AP G W P Sbjct: 3092 VAASSGSRGTASAPAGRPWWHP 3027 Score = 23.5 bits (45), Expect(2) = 9.8 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -3 / -2 Query: 171 P*TRMRRCSPSPRGASGRGPCRTSPAP 91 P + RR PR A+ CR P P Sbjct: 2935 PRPQCRRRRRRPRSAAASSRCRPRPCP 2855
>LOC_Os07g31884:12007.t02873:unspliced-genomic transparent testa 12 protein, putative, expressed| Length = 6914 Score = 29.5 bits (58), Expect(2) = 9.8 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 / +1 Query: 162 RMRRCSPSPRGASGRGPCRTSPA 94 R R SPSP ++ G CR SP+ Sbjct: 4990 RSRGSSPSPSSSASSGTCRRSPS 5058 Score = 22.1 bits (42), Expect(2) = 9.8 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -1 / +1 Query: 62 WVGLLCGRSLQ 30 W+GL+CG + Q Sbjct: 6220 WMGLICGLTCQ 6252
>LOC_Os03g29810:12003.t02594:unspliced-genomic ATP-dependent Clp protease proteolytic subunit 3, putative, expressed| Length = 3469 Score = 26.3 bits (51), Expect(2) = 9.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 / -2 Query: 374 IIPSVPDKTITVIIHHGSCCILIQFSIK 457 ++ +VPD+T HG C L+ +IK Sbjct: 2013 LLSAVPDQTQLAQSQHGKCSCLVCTTIK 1930 Score = 24.4 bits (47), Expect(2) = 9.9 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 / -3 Query: 343 ERNCSIRCCYYNTICP 390 +R+ S+ CC + +CP Sbjct: 2840 KRSLSVHCCTISKVCP 2793
>LOC_Os05g42340:12005.t03770:unspliced-genomic conserved hypothetical protein| Length = 915 Score = 25.4 bits (49), Expect(2) = 10.0 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 / +1 Query: 144 PSPRGASGRGPCRTSPAPMERYTSWQR 64 P PR G P R SP+P + QR Sbjct: 529 PPPRREPGERPTRRSPSPATKRPPDQR 609 Score = 23.5 bits (45), Expect(2) = 10.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 / +2 Query: 162 RMRRCSPSPR 133 R RRCSP PR Sbjct: 134 RSRRCSPRPR 163 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 192,088,427 Number of extensions: 3008271 Number of successful extensions: 25403 Number of sequences better than 10.0: 174 Length of query: 157 Length of database: 55,613,886 Length adjustment: 47 Effective length of query: 110 Effective length of database: 52,968,820 Effective search space: 5826570200 Effective search space used: 5826570200 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
